HAPLN1 Antibody (5O9U2) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 250-354 of human HAPLN1 (P10915). VFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
HAPLN1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HAPLN1 Antibody (5O9U2)
Background
Th extracellular matrix of cartilage consists of a number of interacting macromolecules that are unique to that tissue. The most studied group of these molecules are those that make up the ternary complex involving proteoglycan monomer, link protein (LP) , and hyaluronic acid (HA). As many as 100 proteoglycan monomers and LPs can be found to interact with a single HA polymer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: COMET, IHC, IHC-P, mIF
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for HAPLN1 Antibody (NBP3-16486) (0)
There are no publications for HAPLN1 Antibody (NBP3-16486).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HAPLN1 Antibody (NBP3-16486) (0)
There are no reviews for HAPLN1 Antibody (NBP3-16486).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HAPLN1 Antibody (NBP3-16486) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HAPLN1 Products
Research Areas for HAPLN1 Antibody (NBP3-16486)
Find related products by research area.
|
Blogs on HAPLN1