HAP40 Antibody - BSA Free

Immunohistochemistry-Paraffin: HAP40 Antibody [NBP2-54731] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: HAP40 Antibody [NBP2-54731] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HAP40 Antibody [NBP2-54731] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HAP40 Antibody [NBP2-54731] - Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HAP40 Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit HAP40 Antibody - BSA Free (NBP2-54731) is a polyclonal antibody validated for use in IHC and WB. Anti-HAP40 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: LLQPPPAKLLPEHAQTLEKYSWEAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTAEQNHLLHLVLQETISPSGQGV
• Predicted Species: Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: F8A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HAP40 Recombinant Protein Antigen (NBP2-54731PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HAP40 Antibody - BSA Free

• coagulation factor VIII-associated (intronic transcript) 1
• coagulation factor VIII-associated 1
• cpG island protein
• DXS522E
• F8A
• factor VIII associated protein
• factor VIII intron 22 protein
• HAP40
• huntingtin-associated protein 40

Background

HAP40 is a 40 kDa Huntington-associated protein. It is likely to contribute to the function of normal Huntington and is a candidate for involvement in the aberrant nuclear localization of mutant Huntington, found in degenerating neurons of Huntingtons disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HAP40 Antibody (NBP2-54731)(3)

Publications using NBP2-54731

• Alteen MG, Deme JC, Alvarez CP et al. Delineation of functional subdomains of Huntingtin protein and their interaction with HAP40 Structure (London, England : 1993) 2023-06-20 [PMID: 37390814] (Western Blot)
• Dominguez Martinez M Detection and characterization of Huntingtin-protein interactions using resonance energy transfer methodologies Thesis 2023-01-01 (WB, KO, Human)
• Harding RJ, Deme JC, Hevler JF et al. Huntingtin structure is orchestrated by HAP40 and shows a polyglutamine expansion-specific interaction with exon 1 Communications biology 2021-12-08 [PMID: 34880419] (WB, Mouse)

Bioinformatics

• Gene Symbol: F8A1