| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: LLQPPPAKLLPEHAQTLEKYSWEAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTAEQNHLLHLVLQETISPSGQGV |
| Predicted Species | Mouse (92%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | F8A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP2-54731 | Applications | Species |
|---|---|---|
| Alteen MG, Deme JC, Alvarez CP et al. Delineation of functional subdomains of Huntingtin protein and their interaction with HAP40 Structure (London, England : 1993) 2023-06-20 [PMID: 37390814] (Western Blot) | Western Blot | |
| Dominguez Martinez M Detection and characterization of Huntingtin-protein interactions using resonance energy transfer methodologies Thesis 2023-01-01 (WB, KO, Human) | WB, KO | Human |
| Harding RJ, Deme JC, Hevler JF et al. Huntingtin structure is orchestrated by HAP40 and shows a polyglutamine expansion-specific interaction with exon 1 Communications biology 2021-12-08 [PMID: 34880419] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for HAP40 Antibody (NBP2-54731)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | F8A1 |