HAO2 Antibody


Western Blot: HAO2 Antibody [NBP1-53164] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

HAO2 Antibody Summary

Synthetic peptides corresponding to HAO2(hydroxyacid oxidase 2 (long chain)) The peptide sequence was selected from the N terminal of HAO2. Peptide sequence DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HAO2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HAO2 Antibody

  • (S)-2-hydroxy-acid oxidase, peroxisomal
  • Cell growth-inhibiting gene 16 protein
  • EC
  • GIG16
  • growth-inhibiting protein 16
  • HAOX2glycolate oxidase
  • hydroxyacid oxidase 2 (long chain)
  • hydroxyacid oxidase 2
  • Long chain alpha-hydroxy acid oxidase
  • Long-chain L-2-hydroxy acid oxidase


HAO2 is one of three related proteins that have 2-hydroxyacid oxidase activity yet differ in amino acid sequence, tissue expression and substrate preference. Subcellular location of the protein is the peroxisome. Specifically, the protein is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described.This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ye
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HAO2 Antibody (NBP1-53164) (0)

There are no publications for HAO2 Antibody (NBP1-53164).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAO2 Antibody (NBP1-53164) (0)

There are no reviews for HAO2 Antibody (NBP1-53164). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HAO2 Antibody (NBP1-53164) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HAO2 Products

Bioinformatics Tool for HAO2 Antibody (NBP1-53164)

Discover related pathways, diseases and genes to HAO2 Antibody (NBP1-53164). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAO2 Antibody (NBP1-53164)

Discover more about diseases related to HAO2 Antibody (NBP1-53164).

Pathways for HAO2 Antibody (NBP1-53164)

View related products by pathway.

Blogs on HAO2

There are no specific blogs for HAO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HAO2 Antibody and receive a gift card or discount.


Gene Symbol HAO2