HADHB Antibody - BSA Free

Western Blot: HADHB Antibody [NBP2-56259] - Analysis using Anti-HADHB antibody NBP2-56259 (A) shows similar pattern to independent antibody NBP1-82609 (B).

Immunocytochemistry/Immunofluorescence: HADHB Antibody [NBP2-56259] - Staining of human cell line U-2 OS shows localization to mitochondria.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HADHB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HADHB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HADHB Recombinant Protein Antigen (NBP2-56259PEP)

Reactivity Notes

Mouse 84%, Rat 81%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HADHB Antibody - BSA Free

• 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit
• 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein
• acetyl-CoA acyltransferase
• beta subunit
• beta-ketothiolase
• EC 2.3.1
• EC 2.3.1.16
• ECHB
• hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit
• hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit
• hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
• MGC87480
• mitochondrial trifunctional enzyme, beta subunit
• mitochondrial trifunctional protein, beta subunit
• MTPB
• TP-beta
• trifunctional enzyme subunit beta, mitochondrial

Background

HADHB encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HADHB