HADHB Antibody - BSA Free

Western Blot: HADHB Antibody [NBP1-54750] - Titration: 0.25ug/ml Positive Control: HepG2 cell lysate.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HADHB Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to HADHB(hydroxyacyl-Coenzyme A dehydrogenase (trifunctional protein), beta subunit) The peptide sequence was selected from the C terminal of HADHB. Peptide sequence LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: beta, mitochondrial.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HADHB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:10.1371/journal.pbio.3000988).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HADHB Antibody - BSA Free

• 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit
• 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein
• acetyl-CoA acyltransferase
• beta subunit
• beta-ketothiolase
• EC 2.3.1
• EC 2.3.1.16
• ECHB
• hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit
• hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit
• hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
• MGC87480
• mitochondrial trifunctional enzyme, beta subunit
• mitochondrial trifunctional protein, beta subunit
• MTPB
• TP-beta
• trifunctional enzyme subunit beta, mitochondrial

Background

HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.This gene encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HADHB Antibody (NBP1-54750)(1)

Publication using NBP1-54750

• Mori H, Dugan CE, Nishii A et al. The molecular and metabolic program by which white adipocytes adapt to cool physiologic temperatures PLoS biology 2021-05-01 [PMID: 33979328] (WB, Mouse)

Bioinformatics

• Gene Symbol: HADHB
• Uniprot:
  • P55084(Human)