HADHB Antibody

Images

 
Western Blot: HADHB Antibody [NBP1-54750] - Titration: 0.25ug/ml Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HADHB Antibody Summary

Immunogen
Synthetic peptides corresponding to HADHB(hydroxyacyl-Coenzyme A dehydrogenase (trifunctional protein), beta subunit) The peptide sequence was selected from the C terminal of HADHB. Peptide sequence LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANF
Specificity
This product is specific to Subunit or Isoform: beta, mitochondrial.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HADHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against HADHB and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HADHB Antibody

  • 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit
  • 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein
  • acetyl-CoA acyltransferase
  • beta subunit
  • beta-ketothiolase
  • EC 2.3.1
  • EC 2.3.1.16
  • ECHB
  • hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit
  • hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit
  • hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
  • MGC87480
  • mitochondrial trifunctional enzyme, beta subunit
  • mitochondrial trifunctional protein, beta subunit
  • MTPB
  • TP-beta
  • trifunctional enzyme subunit beta, mitochondrial

Background

HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.This gene encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67334
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-83387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31441
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP1-62489
Species: Hu, Mu
Applications: WB
NB100-53791
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, Dual ISH-IHC, GS, KD, PCR
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP1-54750
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HADHB Antibody (NBP1-54750) (0)

There are no publications for HADHB Antibody (NBP1-54750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HADHB Antibody (NBP1-54750) (0)

There are no reviews for HADHB Antibody (NBP1-54750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HADHB Antibody (NBP1-54750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HADHB Products

Bioinformatics Tool for HADHB Antibody (NBP1-54750)

Discover related pathways, diseases and genes to HADHB Antibody (NBP1-54750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HADHB Antibody (NBP1-54750)

Discover more about diseases related to HADHB Antibody (NBP1-54750).
 

Pathways for HADHB Antibody (NBP1-54750)

View related products by pathway.

PTMs for HADHB Antibody (NBP1-54750)

Learn more about PTMs related to HADHB Antibody (NBP1-54750).

Blogs on HADHB

There are no specific blogs for HADHB, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HADHB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HADHB
Uniprot
COVID-19 update