Guanylyl Cyclase beta 1 Antibody


Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869] - Fetal Brain lysates, Antibody Dilution: 0.5 ug/ml.
Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Guanylyl Cyclase beta 1 Antibody Summary

Synthetic peptides corresponding to GUCY1B3(guanylate cyclase 1, soluble, beta 3) The peptide sequence was selected from the N terminal of GUCY1B3 (NP_000848). Peptide sequence LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV.
This product is specific to Subunit or Isofrom: beta-1.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.


  • Western Blot 0.2-1 ug/ml
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-58869 in the following applications:

  • WB
    1 publication


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Guanylyl Cyclase beta 1 Antibody

  • EC
  • GC-SB3
  • GCS-beta-1
  • GCS-beta-3
  • guanylate cyclase 1, soluble, beta 3
  • guanylate cyclase soluble subunit beta-1
  • Guanylate cyclase soluble subunit beta-3
  • GUCSB3GC-S-beta-1
  • GUCY1B1
  • Soluble guanylate cyclase small subunit


Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs (Zabel et al., 1998 [PubMed 9742212]).Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs (Zabel et al., 1998 [PubMed 9742212]).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Fe, Fi, Rb, Xp
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-WhMt
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Guanylyl Cyclase beta 1 Antibody (NBP1-58869) (0)

There are no reviews for Guanylyl Cyclase beta 1 Antibody (NBP1-58869). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Guanylyl Cyclase beta 1 Antibody (NBP1-58869) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Guanylyl Cyclase beta 1 Antibody Products

Related Products by Gene

Bioinformatics Tool for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)

Discover related pathways, diseases and genes to Guanylyl Cyclase beta 1 Antibody (NBP1-58869). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)

Discover more about diseases related to Guanylyl Cyclase beta 1 Antibody (NBP1-58869).

Pathways for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)

View related products by pathway.

PTMs for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)

Learn more about PTMs related to Guanylyl Cyclase beta 1 Antibody (NBP1-58869).

Blogs on Guanylyl Cyclase beta 1

There are no specific blogs for Guanylyl Cyclase beta 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Guanylyl Cyclase beta 1 Antibody and receive a gift card or discount.


Gene Symbol GUCY1B3

Customers Who Bought This Also Bought