Guanylyl Cyclase beta 1 Antibody

Images

 
Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869] - Fetal Brain lysates, Antibody Dilution: 0.5 ug/ml.
Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Concentration
LYOPH mg/ml

Order Details

Guanylyl Cyclase beta 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to GUCY1B3(guanylate cyclase 1, soluble, beta 3) The peptide sequence was selected from the N terminal of GUCY1B3 (NP_000848). Peptide sequence LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV.
Specificity
This product is specific to Subunit or Isofrom: beta-1.
Clonality
Polyclonal
Host
Rabbit
Gene
GUCY1B3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
LYOPH mg/ml
Purity
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-58869 in the following applications:

  • WB
    1 publication

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Guanylyl Cyclase beta 1 Antibody

  • EC 4.6.1.2
  • GC-SB3
  • GCS-beta-1
  • GCS-beta-3
  • guanylate cyclase 1, soluble, beta 3
  • guanylate cyclase soluble subunit beta-1
  • Guanylate cyclase soluble subunit beta-3
  • GUC1B3GUCB3
  • GUCSB3GC-S-beta-1
  • GUCY1B1
  • Soluble guanylate cyclase small subunit

Background

Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs (Zabel et al., 1998 [PubMed 9742212]).Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs (Zabel et al., 1998 [PubMed 9742212]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13000
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB9028
Species: Hu
Applications: WB
NBP1-84689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt, Po, Av, Fe, Fi, Rb, Xp
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF
NBP1-19629
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86139
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56514
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-WhMt
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58869
Species: Hu
Applications: WB

Publications for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Guanylyl Cyclase beta 1 Antibody (NBP1-58869) (0)

There are no reviews for Guanylyl Cyclase beta 1 Antibody (NBP1-58869). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Guanylyl Cyclase beta 1 Antibody (NBP1-58869) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Guanylyl Cyclase beta 1 Antibody Products

Related Products by Gene

Bioinformatics Tool for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)

Discover related pathways, diseases and genes to Guanylyl Cyclase beta 1 Antibody (NBP1-58869). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)

Discover more about diseases related to Guanylyl Cyclase beta 1 Antibody (NBP1-58869).
 

Pathways for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)

View related products by pathway.

PTMs for Guanylyl Cyclase beta 1 Antibody (NBP1-58869)

Learn more about PTMs related to Guanylyl Cyclase beta 1 Antibody (NBP1-58869).

Blogs on Guanylyl Cyclase beta 1

There are no specific blogs for Guanylyl Cyclase beta 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol GUCY1B3
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-58869 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought