![Western Blot: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Analysis of extracts of various cell lines, using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (NBP3-16248) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/Guanylyl-Cyclase-beta-1-Antibody-5O8D9-Western-Blot-NBP3-16248-img0003.jpg "Western Blot: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Analysis of extracts of various cell lines, using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (NBP3-16248) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 5O8D9 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit Guanylyl Cyclase beta 1 Antibody (5O8D9) (NBP3-16248) is a recombinant monoclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-Guanylyl Cyclase beta 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (Q02153). MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQN |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | GUCY1B1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Sophie E |
IHC-P | Rat | 06/23/2025 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Guanylyl Cyclase beta 1 Antibody (NBP3-16248)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GUCY1B1 |
![Immunocytochemistry/Immunofluorescence: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunofluorescence analysis of NIH-3T3 cells using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (NBP3-16248) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Guanylyl-Cyclase-beta-1-Antibody-5O8D9-Immunocytochemistry-Immunofluorescence-NBP3-16248-img0002.jpg "Immunocytochemistry/Immunofluorescence: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunofluorescence analysis of NIH-3T3 cells using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (NBP3-16248) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Guanylyl Cyclase beta 1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16248_rabbit-guanylyl-cyclase-beta-1-mab-5o8d9-5220251215476.jpg "Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Guanylyl Cyclase beta 1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Guanylyl Cyclase beta 1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16248_rabbit-guanylyl-cyclase-beta-1-mab-5o8d9-52202511374189.jpg "Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Guanylyl Cyclase beta 1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![N/A Angiopoietin-2 [HRP]](https://images.novusbio.com/images2/Angiopoietin-2_DANG20_ELISA_30.jpg)
![N/A Angiopoietin-2 [HRP]](https://images.novusbio.com/images2/DATA_Angiopoietin2_DANG20_ELISA_574.jpg)
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![Immunohistochemistry VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R1_AF321_Immunohistochemistry_6778.jpg)
![Immunohistochemistry VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R1_AF321_Immunohistochemistry_9337.jpg)
![Western Blot VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af321_human-vegf-r1-flt-1-affinity-purified-polyclonal-ab-8220249511449.jpg)
![Western Blot CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Western_Blot_17043.jpg)
![Simple Western CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Immunohistochemistry_17641.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
