| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 5O8D9 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit Guanylyl Cyclase beta 1 Antibody (5O8D9) (NBP3-16248) is a recombinant monoclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-Guanylyl Cyclase beta 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (Q02153). MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQN |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | GUCY1B1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Sophie E |
IHC-P | Rat | 06/23/2025 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Guanylyl Cyclase beta 1 Antibody (NBP3-16248)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GUCY1B1 |