gtf3c3 Antibody (2D8)

Images

 
Western Blot: gtf3c3 Antibody (2D8) [H00009330-M01] - GTF3C3 monoclonal antibody (M01), clone 2D8. Analysis of GTF3C3 expression in Raw 264.7.
Western Blot: gtf3c3 Antibody (2D8) [H00009330-M01] - GTF3C3 monoclonal antibody (M01), clone 2D8 Analysis of GTF3C3 expression in Hela S3 NE.
Western Blot: gtf3c3 Antibody (2D8) [H00009330-M01] - GTF3C3 monoclonal antibody (M01), clone 2D8. Analysis of GTF3C3 expression in NIH/3T3.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
2D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

gtf3c3 Antibody (2D8) Summary

Immunogen
GTF3C3 (NP_036218, 112 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPEQPTAGDVFVLEMVLNRETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNP
Specificity
GTF3C3 (2D8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GTF3C3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for gtf3c3 Antibody (2D8)

  • general transcription factor 3C polypeptide 3
  • general transcription factor IIIC, polypeptide 3, 102kDa
  • TF3C-gamma
  • TFIIIC 102 kDa subunit
  • TFIIIC102general transcription factor IIIC, polypeptide 3 (102kD)
  • TFiiiC2-102
  • TFIIICgamma
  • Transcription factor IIIC 102 kDa subunit
  • Transcription factor IIIC subunit gamma
  • transcription factor IIIC, 102 kD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-60657
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP (-), WB
NB100-56137
Species: Bv, Ca, Hu, Pm, Rt
Applications: IHC, IHC-P, IP, WB
H00008837-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-56125
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-31686
Species: Hu, Mu
Applications: ICC/IF, WB
MAB7047
Species: Hu
Applications: ICC, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-80461
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00009360-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-84610
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-92685
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-89306
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP2-22152
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
H00009330-M01
Species: Hu, Mu
Applications: WB, ELISA

Publications for gtf3c3 Antibody (H00009330-M01) (0)

There are no publications for gtf3c3 Antibody (H00009330-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gtf3c3 Antibody (H00009330-M01) (0)

There are no reviews for gtf3c3 Antibody (H00009330-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gtf3c3 Antibody (H00009330-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional gtf3c3 Products

Bioinformatics Tool for gtf3c3 Antibody (H00009330-M01)

Discover related pathways, diseases and genes to gtf3c3 Antibody (H00009330-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gtf3c3 Antibody (H00009330-M01)

Discover more about diseases related to gtf3c3 Antibody (H00009330-M01).
 

Pathways for gtf3c3 Antibody (H00009330-M01)

View related products by pathway.

Blogs on gtf3c3

There are no specific blogs for gtf3c3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gtf3c3 Antibody (2D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3C3
Entrez
OMIM
Uniprot