GTF2IRD1 Recombinant Protein Antigen

Images

 
There are currently no images for GTF2IRD1 Protein (NBP1-91973PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GTF2IRD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF2IRD1.

Source: E. coli

Amino Acid Sequence: RPCTYGVPKLKRILEERHSIHFIIKRMFDERIFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSEDSGYGMEMLTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF2IRD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91973.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GTF2IRD1 Recombinant Protein Antigen

  • BEN
  • CREAM1
  • general transcription factor II-I repeat domain-containing protein 1
  • General transcription factor III
  • GTF2I repeat domain containing 1
  • GTF2I repeat domain-containing protein 1
  • GTF3GTF2I repeat domain-containing 1
  • hMusTRD1alpha1
  • muscle TFII-I repeat domain-containing protein 1 alpha 1
  • Muscle TFII-I repeat domain-containing protein 1
  • MusTRD1
  • MusTRD1/BEN
  • MUSTRD1general transcription factor 3
  • RBAP2WBSCR12binding factor for early enhancer
  • Slow-muscle-fiber enhancer-binding protein
  • USE B1-binding protein
  • WBS
  • WBSCR11
  • Williams-Beuren syndrome chromosomal region 11 protein
  • Williams-Beuren syndrome chromosomal region 12 protein
  • Williams-Beuren syndrome chromosome region 11

Background

GTF2IRD1 is encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing of this gene generates at least 2 transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8306
Species: Hu
Applications: IHC, WB
NB100-61054
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB6734
Species: Hu
Applications: IHC
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2836
Species: Mu
Applications: WB
H00006941-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-37003
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-47935
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
AF2654
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-85016
Species: Hu
Applications: IHC,  IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
MAB7665
Species: Hu
Applications: IHC, WB
AF1172
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB100-1414
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
NBP1-91973PEP
Species: Hu
Applications: AC

Publications for GTF2IRD1 Protein (NBP1-91973PEP) (0)

There are no publications for GTF2IRD1 Protein (NBP1-91973PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2IRD1 Protein (NBP1-91973PEP) (0)

There are no reviews for GTF2IRD1 Protein (NBP1-91973PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GTF2IRD1 Protein (NBP1-91973PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF2IRD1 Products

Blogs on GTF2IRD1

There are no specific blogs for GTF2IRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GTF2IRD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2IRD1