GRSF1 Antibody - Azide and BSA Free

Western Blot: GRSF1 Antibody [NBP2-94114] - Analysis of extracts of various cell lines, using GRSF1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.

Immunocytochemistry/Immunofluorescence: GRSF1 Antibody [NBP2-94114] - Analysis of L929 cells using GRSF1 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP2-94114] - Human esophageal cancer using GRSF1 Rabbit pAb at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP2-94114] - Mouse brain using GRSF1 Rabbit pAb at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP2-94114] - Rat liver using GRSF1 Rabbit pAb at dilution of 1:100 (40x lens).

Immunocytochemistry/ Immunofluorescence: GRSF1 Antibody - Azide and BSA Free [GRSF1] - Immunofluorescence analysis of C6 cells using GRSF1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GRSF1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit GRSF1 Antibody - Azide and BSA Free (NBP2-94114) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GRSF1 (NP_002083.4). SLLPQSLAAAAAVPTRSYSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRSF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for GRSF1 Antibody - Azide and BSA Free

• FLJ13125
• G-rich RNA sequence binding factor 1
• G-rich sequence factor 1
• GRSF-1

Background

The GRSF1 gene encodes a sequence factor 1 protein that plays a role in binding RNAs that contain the 14 base G-rich element. This protein is located in the cytoplasm and encourages transmission of viral mRNAs in vitro. It codes for two isoforms: Isoform 1 is 480 amino acids long at 53 kDA while isoform 2 is 318 amino acids long at a mass of approximately 36 kDA. The GRSF1 gene interacts with the ICT1, FTSJ1, APC, ULK2, and GABARAP genes. Research on influenza and neuronitis have explored the role of GRSF1 in the development of these diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GRSF1