GRSF1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GRSF1 Antibody [NBP1-89488] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human adrenal gland, colon, lymph node and pancreas using Anti-GRSF1 antibody NBP1-89488 (A) shows similar protein distribution across tissues to independent antibody NBP2-38341 (B).

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human lymph node shows moderate granular cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human adrenal gland.

Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Staining of human testis shows weak to moderate granular cytoplasmic positivity in cells in seminiferous ducts.

Staining of human pancreas shows moderate granular cytoplasmic positivity in islets of Langerhans.

Western Blot: GRSF1 Antibody [NBP1-89488] - Analysis using Anti-GRSF1 antibody NBP1-89488 (A) shows similar pattern to independent antibody NBP2-38341 (B).

Analysis in human cell line MOLT-4.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRSF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GRSF1 Antibody - BSA Free (NBP1-89488) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRSF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GRSF1 Protein (NBP1-89488PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRSF1 Antibody - BSA Free

• FLJ13125
• G-rich RNA sequence binding factor 1
• G-rich sequence factor 1
• GRSF-1

Background

The GRSF1 gene encodes a sequence factor 1 protein that plays a role in binding RNAs that contain the 14 base G-rich element. This protein is located in the cytoplasm and encourages transmission of viral mRNAs in vitro. It codes for two isoforms: Isoform 1 is 480 amino acids long at 53 kDA while isoform 2 is 318 amino acids long at a mass of approximately 36 kDA. The GRSF1 gene interacts with the ICT1, FTSJ1, APC, ULK2, and GABARAP genes. Research on influenza and neuronitis have explored the role of GRSF1 in the development of these diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRSF1