GRSF1 Antibody

Images

 
Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat
Western Blot: GRSF1 Antibody [NBP1-57316] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Brain. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Heart. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Brain. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Liver. Concentration1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Lung. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316] - Jurkat. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Liver. Concentration1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316] - Hela. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRSF1 Antibody Summary

Immunogen
Synthetic peptides corresponding to GRSF1(G-rich RNA sequence binding factor 1) The peptide sequence was selected from the middle region of GRSF1 (NP_002083). Peptide sequence IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRSF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-57316 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
From PBS.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GRSF1 Antibody

  • FLJ13125
  • G-rich RNA sequence binding factor 1
  • G-rich sequence factor 1
  • GRSF-1

Background

GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. The protein is localized in the cytoplasm, and has been shown to stimulate translation of viral mRNAs in vitro. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2437
Species: Rt
Applications: WB, PEP-ELISA
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-385
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02221
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP2-20329
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38012
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00001996-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P, RNAi
NBP1-83180
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
NBP2-37454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-57316
Species: Hu
Applications: WB

Publications for GRSF1 Antibody (NBP1-57316)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GRSF1 Antibody (NBP1-57316) (0)

There are no reviews for GRSF1 Antibody (NBP1-57316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRSF1 Antibody (NBP1-57316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GRSF1 Antibody (NBP1-57316)

Discover related pathways, diseases and genes to GRSF1 Antibody (NBP1-57316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRSF1 Antibody (NBP1-57316)

Discover more about diseases related to GRSF1 Antibody (NBP1-57316).
 

Pathways for GRSF1 Antibody (NBP1-57316)

View related products by pathway.

PTMs for GRSF1 Antibody (NBP1-57316)

Learn more about PTMs related to GRSF1 Antibody (NBP1-57316).

Blogs on GRSF1

There are no specific blogs for GRSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRSF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRSF1
Entrez
Uniprot