GRSF1 Antibody - BSA Free

Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Western Blot: GRSF1 Antibody [NBP1-57316] - Hela cell lysate, concentration 0.2-1 ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Brain. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Heart. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Brain. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Liver. Concentration1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Lung. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Jurkat. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Liver. Concentration1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Hela. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GRSF1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GRSF1(G-rich RNA sequence binding factor 1) The peptide sequence was selected from the middle region of GRSF1 (NP_002083). Peptide sequence IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRSF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GRSF1 Antibody - BSA Free

• FLJ13125
• G-rich RNA sequence binding factor 1
• G-rich sequence factor 1
• GRSF-1

Background

GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. The protein is localized in the cytoplasm, and has been shown to stimulate translation of viral mRNAs in vitro. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRSF1 Antibody (NBP1-57316)(1)

Publication using NBP1-57316

• Ren YR, Chaerkady R, Hu S et al. Unbiased discovery of interactions at a control locus driving expression of the cancer-specific therapeutic and diagnostic target, mesothelin J Proteome Res 2012-10-01 [PMID: 23025254] (WB, Human)

Bioinformatics

• Gene Symbol: GRSF1
• Entrez:
  • 2926(Human)
• Uniprot:
  • Q12849(Human)