GRSF1 Antibody

Images

 
Western Blot: GRSF1 Antibody [NBP1-57315] - HepG2 cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRSF1 Antibody Summary

Immunogen
Synthetic peptides corresponding to GRSF1 (G-rich RNA sequence binding factor 1) The peptide sequence was selected from the N terminal of GRSF1. Peptide sequence SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRSF1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GRSF1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GRSF1 Antibody

  • FLJ13125
  • G-rich RNA sequence binding factor 1
  • G-rich sequence factor 1
  • GRSF-1

Background

GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-385
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02221
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP2-20329
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38012
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00001996-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P, RNAi
NBP2-24567
Species: Hu
Applications: WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-57315
Species: Hu
Applications: WB

Publications for GRSF1 Antibody (NBP1-57315) (0)

There are no publications for GRSF1 Antibody (NBP1-57315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRSF1 Antibody (NBP1-57315) (0)

There are no reviews for GRSF1 Antibody (NBP1-57315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRSF1 Antibody (NBP1-57315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GRSF1 Antibody (NBP1-57315)

Discover related pathways, diseases and genes to GRSF1 Antibody (NBP1-57315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRSF1 Antibody (NBP1-57315)

Discover more about diseases related to GRSF1 Antibody (NBP1-57315).
 

Pathways for GRSF1 Antibody (NBP1-57315)

View related products by pathway.

PTMs for GRSF1 Antibody (NBP1-57315)

Learn more about PTMs related to GRSF1 Antibody (NBP1-57315).

Blogs on GRSF1

There are no specific blogs for GRSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRSF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRSF1