GRP78/HSPA5 Antibody - BSA Free

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89969] - Staining in human placenta and skeletal muscle tissues.. Corresponding HSPA5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89969] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89969] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89969] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89969] - Staining of human rectum shows strong cytoplasmic positivity in glandular and lymphoid cells.

Analysis in human cell line HepG2.

Western Blot: GRP78/HSPA5 Antibody [NBP1-89969] - Analysis using Anti-HSPA5 antibody NBP1-89969 (A) shows similar pattern to independent antibody NBP1-89968 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRP78/HSPA5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKL
• Marker: ER Stress Marker
• Predicted Species: Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSPA5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC, Retrieval method: HIER pH6
• Control Peptide:

  GRP78/HSPA5 Protein (NBP1-89969PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33296727)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRP78/HSPA5 Antibody - BSA Free

• 78 kDa glucose-regulated protein
• BIP
• Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78
• FLJ26106
• GRP78
• GRP-78
• GRP78BIP
• Heat shock 70 kDa protein 5
• heat shock 70kD protein 5 (glucose-regulated protein, 78kD)
• heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
• HSP70-5
• HSPA5
• Immunoglobulin heavy chain-binding protein
• MIF2

Background

Within the ER, misfolded proteins are detected by Bip (GPR78). In the presence of misfolded proteins, GPR78 disscociates from PERK, allowing it to homodimerize and autophosphoyate. In its dimerized phosphorylated form, PERK phosphorylates eIF2. The phosphorylation of eIF2 blocks the majority of translation to prevent the continued accumulation of protein in the ER. GRP78 also binds to IRE1 and ATF6 under normal ER conditions, but dissociates upon accumulation of misfolded proteins. Unbound ATF6 is translocated to the gogli where it is converted into a cleaved, active form. The cleaved form of ATF6 is then able to up regulate transcription of UPR genes including XBP1. Activated IRE1 acts as an endoribonuclease to an intron from XBP1 transcripts. The XBP1 splice variant codes for an active transcription factor which activates transcription of P58IPK. P58IPK is a HSP40 protein which binds to and inhibits PERK. Thus, if the accumulated misfolded proteins have been removed, P58IPK acts to shut down the UPR by removing the block to translation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRP78/HSPA5 Antibody (NBP1-89969)(2)

Publications using NBP1-89969

• Y?ld?z B�l�kba?? E, Karolak JA, Gambin T et al. Do paternal deletions involving the FOXF1 locus on chromosome 16q24.1 manifest with more severe non-lung anomalies? European Journal of Medical Genetics 2022-06-01 [PMID: 35533956] (Western Blot, Mouse)
• Wang Y, Wen W, Li H et al. MANF is neuroprotective against ethanol-induced neurodegeneration through ameliorating ER stress Neurobiology of disease 2020-12-06 [PMID: 33296727] (WB, Mouse)

Bioinformatics

• Gene Symbol: HSPA5