Growth Hormone R Antibody

Images

 
Immunohistochemistry-Paraffin: Growth Hormone R Antibody [NBP2-58925] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: Growth Hormone R Antibody [NBP2-58925] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: Growth Hormone R Antibody [NBP2-58925] - Staining in human liver and lymph node tissues using anti-GHR antibody. Corresponding GHR RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Growth Hormone R Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF
Specificity
Specificity of human Growth Hormone R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GHR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Growth Hormone R Recombinant Protein Antigen (NBP2-58925PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Growth Hormone R Antibody

  • GH receptor
  • GHBP
  • GHR
  • growth hormone binding protein
  • Growth Hormone R
  • growth hormone receptor
  • serum binding protein
  • Somatotropin receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
NB100-64650
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB391
Species: Hu, Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-58925
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Growth Hormone R Antibody (NBP2-58925) (0)

There are no publications for Growth Hormone R Antibody (NBP2-58925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Growth Hormone R Antibody (NBP2-58925) (0)

There are no reviews for Growth Hormone R Antibody (NBP2-58925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Growth Hormone R Antibody (NBP2-58925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Growth Hormone R Antibody (NBP2-58925)

Discover related pathways, diseases and genes to Growth Hormone R Antibody (NBP2-58925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Growth Hormone R Antibody (NBP2-58925)

Discover more about diseases related to Growth Hormone R Antibody (NBP2-58925).
 

Pathways for Growth Hormone R Antibody (NBP2-58925)

View related products by pathway.

PTMs for Growth Hormone R Antibody (NBP2-58925)

Learn more about PTMs related to Growth Hormone R Antibody (NBP2-58925).
 

Research Areas for Growth Hormone R Antibody (NBP2-58925)

Find related products by research area.

Blogs on Growth Hormone R

There are no specific blogs for Growth Hormone R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Growth Hormone R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GHR
Entrez