Growth Hormone R Antibody


Immunocytochemistry/ Immunofluorescence: Growth Hormone R Antibody [NBP2-55524] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & cytoplasmic bodies.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

Growth Hormone R Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPP
Specificity of human Growth Hormone R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Growth Hormone R Recombinant Protein Antigen (NBP2-55524PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Growth Hormone R Antibody

  • GH receptor
  • GHBP
  • GHR
  • growth hormone binding protein
  • Growth Hormone R
  • growth hormone receptor
  • serum binding protein
  • Somatotropin receptor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, MiAr
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu, Mu
Applications: WB, Flow, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
Species: Hu
Applications: ICC/IF

Publications for Growth Hormone R Antibody (NBP2-55524) (0)

There are no publications for Growth Hormone R Antibody (NBP2-55524).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Growth Hormone R Antibody (NBP2-55524) (0)

There are no reviews for Growth Hormone R Antibody (NBP2-55524). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Growth Hormone R Antibody (NBP2-55524) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Growth Hormone R Products

Bioinformatics Tool for Growth Hormone R Antibody (NBP2-55524)

Discover related pathways, diseases and genes to Growth Hormone R Antibody (NBP2-55524). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Growth Hormone R Antibody (NBP2-55524)

Discover more about diseases related to Growth Hormone R Antibody (NBP2-55524).

Pathways for Growth Hormone R Antibody (NBP2-55524)

View related products by pathway.

PTMs for Growth Hormone R Antibody (NBP2-55524)

Learn more about PTMs related to Growth Hormone R Antibody (NBP2-55524).

Research Areas for Growth Hormone R Antibody (NBP2-55524)

Find related products by research area.

Blogs on Growth Hormone R

There are no specific blogs for Growth Hormone R, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Growth Hormone R Antibody and receive a gift card or discount.


Gene Symbol GHR