Growth Hormone R Antibody

Images

 
Western Blot: growth hormone receptor Antibody [NBP1-69449] - This Anti-GHR antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Growth Hormone R Antibody Summary

Immunogen
Synthetic peptides corresponding to GHR(growth hormone receptor) The peptide sequence was selected from the N terminal of Growth hormone receptor. Peptide sequence LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GHR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GHR and was validated on Western blot.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Growth Hormone R Antibody

  • GH receptor
  • GHBP
  • GHR
  • growth hormone binding protein
  • Growth Hormone R
  • growth hormone receptor
  • serum binding protein
  • Somatotropin receptor

Background

Growth hormone receptor is a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature.This gene encodes a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. Other splice variants, including one encoding a soluble form of the protein (GHRtr), have been observed but have not been thoroughly characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF2988
Species: Mu, Rt
Applications: WB
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB391
Species: Hu, Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-69449
Species: Hu
Applications: WB

Publications for Growth Hormone R Antibody (NBP1-69449) (0)

There are no publications for Growth Hormone R Antibody (NBP1-69449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Growth Hormone R Antibody (NBP1-69449) (0)

There are no reviews for Growth Hormone R Antibody (NBP1-69449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Growth Hormone R Antibody (NBP1-69449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Growth Hormone R Products

Bioinformatics Tool for Growth Hormone R Antibody (NBP1-69449)

Discover related pathways, diseases and genes to Growth Hormone R Antibody (NBP1-69449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Growth Hormone R Antibody (NBP1-69449)

Discover more about diseases related to Growth Hormone R Antibody (NBP1-69449).
 

Pathways for Growth Hormone R Antibody (NBP1-69449)

View related products by pathway.

PTMs for Growth Hormone R Antibody (NBP1-69449)

Learn more about PTMs related to Growth Hormone R Antibody (NBP1-69449).
 

Research Areas for Growth Hormone R Antibody (NBP1-69449)

Find related products by research area.

Blogs on Growth Hormone R

There are no specific blogs for Growth Hormone R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Growth Hormone R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GHR
Entrez
Uniprot