GRIM19 Antibody - BSA Free

Western Blot: GRIM19 Antibody - Azide and BSA Free [GRIM19] - Western blot analysis of lysates from wild type(WT) and GRIM19 knockdown (KD) 293T cells, using [KD Validated] GRIM19 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 90s.

Western Blot: GRIM19 Antibody - Azide and BSA Free [GRIM19] - Western blot analysis of various lysates, using [KD Validated] GRIM19 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 90s.

Western Blot: GRIM19 Antibody - Azide and BSA Free [GRIM19] - Western blot analysis of lysates from wild type (WT) and GRIM19 knockout (KO) HeLa cells, using [KO Validated] GRIM19 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Western Blot: GRIM19 Antibody - Azide and BSA Free [GRIM19] - Western blot analysis of various lysates using GRIM19 Rabbit pAb at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRIM19 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GRIM19 Antibody - BSA Free (NBP3-03756) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human GRIM19 (NP_057049.5). MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFA13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for GRIM19 Antibody - BSA Free

• B16.6
• CDA016
• Cell death regulatory protein GRIM-19
• cell death-regulatory protein GRIM19
• CI-B16.6
• complex I B16.6 subunit
• Complex I-B16.6
• FLJ58045
• FLJ59191
• Gene associated with retinoic and IFN-induced mortality 19 protein
• Gene associated with retinoic and interferon-induced mortality 19 protein
• GRIM-19CGI-39
• GRIM19NADH-ubiquinone oxidoreductase B16.6 subunit
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

Background

The GRIM19 gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transf

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: NDUFA13