GRID2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GRID2 Antibody [NBP3-35897] - Immunofluorescence analysis of L929 cells using GRID2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: GRID2 Antibody [NBP3-35897] - Western blot analysis of lysates from Mouse brian, using GRID2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: GRID2 Antibody [NBP3-35897] - Immunofluorescence analysis of C6 cells using GRID2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: GRID2 Antibody [NBP3-35897] - Immunofluorescence analysis of U-2 OS cells using GRID2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRID2 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1007 of human GRID2 (NP_001501.2).
  
  Sequence:
  IDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRID2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 113 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for GRID2 Antibody - BSA Free

• B230104L07Rik
• cpr
• creeper
• gluR delta-2 subunit
• GLURD2
• GluRdelta2
• glutamate receptor delta-2 subunit
• glutamate receptor, ionotropic, delta 2
• GRID2
• ho
• hotfoot
• Lc
• lurcher
• minisatellite 10ac detected by probe MMS10
• MMS10-AC
• Ms10ac
• nmf408
• SCAR18
• tpr

Background

Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamategated, cation-specific ion channels. Kainate/AMPA receptors co-localize with NMDA receptors in many synapses and consist of seven structurally related subunits, designated GluR-1 to -7, as well as GluR-delta2. The kainate/AMPA receptors are primarily responsible for the fast excitatory neurotransmission by glutamate whereas the NMDA receptors are functionally characterized by a slow kinetic and a high permeability for Ca2+ ions. The NMDA receptors consist of five subunits: episilon1, 2, 3, 4 and one zeta subunit. The zeta subunit is expressed throughout the brainstem whereas the four episilon subunits display limited distribution. In mice, mutations in the gene encoding GluR-delta2 (GRID2) cause the Lurcher phenotype. The gene encoding human GluR-delta2 maps to chromosome 4q22.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRID2