GRID1 Antibody (1A9) - Azide and BSA Free

Western Blot: GRID1 Antibody (1A9) [H00002894-M01] - GRID1 monoclonal antibody (M01), clone 1A9 Analysis of GRID1 expression in HeLa.

Sandwich ELISA: GRID1 Antibody (1A9) [H00002894-M01] - Detection limit for recombinant GST tagged GRID1 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 1A9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GRID1 Antibody (1A9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GRID1 (NP_060021, 349 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
• Localization: Plasma membrane. Multi-pass membrane protein.
• Specificity: GRID1 - glutamate receptor, ionotropic, delta 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GRID1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GRID1 Antibody (1A9) - Azide and BSA Free

• GluD1
• GluR Delta-1 Subunit
• glutamate receptor delta-1 subunit
• glutamate receptor, ionotropic, delta 1
• GRID1
• KIAA1220GluR delta-1 subunit

Background

GRID1 is subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity (Yamazaki et al., 1992 [PubMed 1372507]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRID1 Antibody (H00002894-M01)(1)

Publication using H00002894-M01

• Gao J, Maison SF, Wu X et al. Orphan Glutamate Receptor delta1 Subunit Required for High-Frequency Hearing. Mol Cell Biol;27(12):4500-12. 2007-06-01 [PMID: 17438141]

Bioinformatics

• Gene Symbol: GRID1
• Entrez:
  • 2894(Human)
• Uniprot:
  • NP_060021()