GRB2 Antibody

Images

 
Independent Antibodies: Western Blot: GRB2 Antibody [NBP2-55209] - Analysis using Anti-GRB2 antibody NBP2-55209 (A) shows similar pattern to independent antibody NBP2-55208 (B).
Immunocytochemistry/ Immunofluorescence: GRB2 Antibody [NBP2-55209] - Staining of human cell line PC-3 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

GRB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Specificity
Specificity of human GRB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
GRB2 Knockout HeLa Cell Lysate
Control Peptide
GRB2 Recombinant Protein Antigen (NBP2-55209PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GRB2 Antibody

  • abundant SRC homology
  • Adapter protein GRB2
  • ASH
  • EGFRBP-GRB2
  • epidermal growth factor receptor-binding protein GRB2
  • GRB2
  • Grb3-3
  • growth factor receptor-bound protein 2
  • growth factor receptor-bound protein 3
  • HT027
  • MST084
  • MSTP084
  • NCKAP2
  • Protein Ash
  • SH2/SH3 adapter GRB2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF1107
Species: Mu
Applications: WB, IHC
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NBP2-67605
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-98675
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-82001
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for GRB2 Antibody (NBP2-55209) (0)

There are no publications for GRB2 Antibody (NBP2-55209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRB2 Antibody (NBP2-55209) (0)

There are no reviews for GRB2 Antibody (NBP2-55209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRB2 Antibody (NBP2-55209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GRB2 Products

Bioinformatics Tool for GRB2 Antibody (NBP2-55209)

Discover related pathways, diseases and genes to GRB2 Antibody (NBP2-55209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRB2 Antibody (NBP2-55209)

Discover more about diseases related to GRB2 Antibody (NBP2-55209).
 

Pathways for GRB2 Antibody (NBP2-55209)

View related products by pathway.

PTMs for GRB2 Antibody (NBP2-55209)

Learn more about PTMs related to GRB2 Antibody (NBP2-55209).
 

Research Areas for GRB2 Antibody (NBP2-55209)

Find related products by research area.

Blogs on GRB2

There are no specific blogs for GRB2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRB2