Granzyme B Antibody

Images

 
Western Blot: Granzyme B Antibody [NBP1-88151] - Analysis in control (vector only transfected HEK293T lysate) and gZMB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: Granzyme B Antibody [NBP1-88151] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: Granzyme B Antibody [NBP1-88151] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells outside reaction center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Granzyme B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GZMB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. ICC/IF reactivity reported in scientific literature (PMID: 22198309).
Control Peptide
Granzyme B Protein (NBP1-88151PEP)
Publications
Read Publication using
NBP1-88151 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Granzyme B Antibody

  • CSPB
  • CTLA-1
  • CTSGL1
  • Fragmentin-2
  • Granzyme B
  • Granzyme-2
  • GRB
  • GrzB
  • GZMB
  • HLP
  • SECT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-46132
Species: Hu
Applications: WB, IHC, IHC-P
126-FL/CF
Species: Hu
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-58965
Species: Hu
Applications: WB, PEP-ELISA

Publications for Granzyme B Antibody (NBP1-88151)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC-P.


Filter By Application
ICC/IF
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Granzyme B Antibody (NBP1-88151) (0)

There are no reviews for Granzyme B Antibody (NBP1-88151). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Granzyme B Antibody (NBP1-88151) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Granzyme B Products

Bioinformatics Tool for Granzyme B Antibody (NBP1-88151)

Discover related pathways, diseases and genes to Granzyme B Antibody (NBP1-88151). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme B Antibody (NBP1-88151)

Discover more about diseases related to Granzyme B Antibody (NBP1-88151).
 

Pathways for Granzyme B Antibody (NBP1-88151)

View related products by pathway.

PTMs for Granzyme B Antibody (NBP1-88151)

Learn more about PTMs related to Granzyme B Antibody (NBP1-88151).

Blogs on Granzyme B.

Caspase 3, the executioner of apoptosis
Caspase-3 enzyme is a member of the family of endoproteases which regulate inflammation and apoptosis signaling networks. Caspase-3 is known as an executioner caspase in apoptosis because of its role in coordinating the destruction of cellular stru...  Read full blog post.

Caspase 9: The Suicidal Cell Whisperer
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. Among the subclass of initiator caspases that include...  Read full blog post.

Caspase 7: The Cell's Suicide Switch
Caspase 7 (also known as CASP7, Mch3, ICE-LAP3, CMH-1) is a member of caspase family of cysteine proteases. It is an apoptosis-related cystein peptidase encoded by the CASP7 gene in humans. CASP7 homologous sequences have been identified in nearly all...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Granzyme B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GZMB
Entrez