Granulin Antibody (1F5)

Images

 
Western Blot: Granulin Antibody (1F5) [H00002896-M01] - GRN monoclonal antibody (M01), clone 1F5 Analysis of GRN expression in HeLa.
Immunocytochemistry/ Immunofluorescence: Granulin Antibody (1F5) [H00002896-M01] - Analysis of monoclonal antibody to GRN on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Granulin Antibody (1F5) [H00002896-M01] - Detection limit for recombinant GST tagged GRN is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Granulin Antibody (1F5) Summary

Immunogen
GRN (NP_002078 494 a.a. - 593 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL
Specificity
GRN (1F5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GRN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Granulin Antibody (1F5)

  • acrogranin
  • GEP
  • GP88
  • granulin
  • granulin-epithelin
  • granulins
  • PC cell-derived growth factor
  • PCDGF
  • PEPI
  • PGRN
  • proepithelin
  • progranulin

Background

Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB7509
Species: Hu
Applications: WB, IHC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
AF842
Species: Hu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1436
Species: Mu
Applications: WB
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002896-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Granulin Antibody (H00002896-M01) (0)

There are no publications for Granulin Antibody (H00002896-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granulin Antibody (H00002896-M01) (0)

There are no reviews for Granulin Antibody (H00002896-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Granulin Antibody (H00002896-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Granulin Products

Bioinformatics Tool for Granulin Antibody (H00002896-M01)

Discover related pathways, diseases and genes to Granulin Antibody (H00002896-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granulin Antibody (H00002896-M01)

Discover more about diseases related to Granulin Antibody (H00002896-M01).
 

Pathways for Granulin Antibody (H00002896-M01)

View related products by pathway.

PTMs for Granulin Antibody (H00002896-M01)

Learn more about PTMs related to Granulin Antibody (H00002896-M01).
 

Research Areas for Granulin Antibody (H00002896-M01)

Find related products by research area.

Blogs on Granulin

There are no specific blogs for Granulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Granulin Antibody (1F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRN
Entrez
OMIM
Uniprot