GPR177/WLS Antibody

Western Blot: GPR177/WLS Antibody [NBP2-85009] - WB Suggested Anti-GPR177 Antibody Titration: 0.5ug/ml. Positive Control: Jurkat cell lysate

Immunohistochemistry: GPR177/WLS Antibody [NBP2-85009] - Human Muscle

Western Blot: GPR177/WLS Antibody [NBP2-85009] - Host: Rabbit. Target Name: GPR177. Sample Type: Human Fetal Liver. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1ug/ml. Peptide Concentration: 5ug/ml. Lysate Quantity: 25ug/lane/lane. Gel Concentra

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GPR177/WLS Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human GPR177/WLS. Peptide sequence: ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WLS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR177/WLS Antibody

• C1orf139
• DKFZp686I0788
• Evi
• EVIchromosome 1 open reading frame 139
• FLJ23091
• G protein-coupled receptor 177
• GPR177
• GPR177wls
• Integral membrane protein GPR177
• MGC131760
• MGC14878
• MRP
• Protein evenness interrupted homolog
• protein wntless homolog
• Putative NF-kappa-B-activating protein 373
• putative NFkB activating protein 373
• Sprinter
• WLS
• wntless homolog (Drosophila)
• Wntless

Background

C1orf139 - chromosome 1 open reading frame 139

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WLS