GPR10 Antibody

Immunohistochemistry-Paraffin: GPR10 Antibody [NBP1-89741] - Staining of human pituitary gland shows moderate cytoplasmic positivity in a subset of cells in anterior lobe.

Immunohistochemistry-Paraffin: GPR10 Antibody [NBP1-89741] - Staining of human pituitary gland shows strong cytoplasmic positivity in subsets of cells in anterior lobe.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GPR10 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRLHR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPR10 Protein (NBP1-89741PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR10 Antibody

• G protein-coupled receptor 10
• GPR10
• GPR10MGC126539
• G-protein coupled receptor 10
• GR3
• hGR3
• MGC126541
• PRLHR
• prolactin releasing hormone receptor
• prolactin releasing peptide receptor
• prolactin-releasing hormone receptor
• prolactin-releasing peptide receptor
• PrRP receptor
• PrRPR

Background

GPR10 (Prolactin releasing hormone receptor/hGR3) is a Releasing Hormone Receptor that controls the secretion of prolactin from the anterior pituitary. Prolactin releasing hormone receptor expression has been documented in human central nervous system (total brain, spinal cord), anterior pituitary, adrenal, cultured placenta decidual cells, and femur, and in rat central nervous system (thalamus, hypothalamus, anterior pituitary), adrenal medulla, testis, and epididymis. An EST has been isolated from a human brain cancer library.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRLHR