PRLH Antibody

Immunohistochemistry: PRLH Antibody [NBP2-68591] - Immunohistochemical staining of human caudate shows strong cytoplasmic positivity in neuronal cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PRLH Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRLH
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for PRLH Antibody

• Preproprolactin-Releasing Peptide
• PRH
• Prolactin Releasing Hormone
• Prolactin-Releasing Hormone
• Prolactin-Releasing Peptide
• PRRP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRLH