GPER/GPR30 Antibody - BSA Free

Staining of human cell line PC-3 shows localization to nucleoplasm, nucleoli, cytosol & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPER/GPR30 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPER/GPR30 Antibody - BSA Free (NBP3-21238) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPER1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPER/GPR30 Antibody - BSA Free

• CEPR
• CEPRG-protein coupled receptor 30
• Chemoattractant receptor-like 2
• chemokine receptor-like 2
• CMKRL2
• CMKRL2MGC99678
• constitutively expressed peptide-like receptor
• DRY12
• DRY12IL8-related receptor DRY12
• FEG-1
• FEG-1mER
• Flow-induced endothelial G-protein coupled receptor 1
• G protein-coupled estrogen receptor 1
• G protein-coupled receptor 30
• GPCR-BR
• GPER
• GPR30
• GPR30GPCR-Br
• G-protein coupled estrogen receptor 1
• heptahelix receptor
• LERGU
• LERGU2
• leucine rich protein in GPR30 3'UTR
• LyGPR
• Lymphocyte-derived G-protein coupled receptor
• Membrane estrogen receptor

Background

GPR30 a former orphan receptor has been linked to estrogen-mediated activation of adenylyl cyclase, release of epidermal growth factor (EGF)-related ligands, and specific estrogen binding.1 GPR30 acts independently of estrogen receptors, ERalpha and ERbeta, to release of heparin-binding EGF and may play a role in breast cancer tumorogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPER1