GPER/GPR30 Antibody


Immunohistochemistry-Paraffin: GPR30 Antibody [NBP1-88096] - Staining of human gall bladder shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

GPER/GPR30 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
Specificity of human GPER/GPR30 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
GPER/GPR30 Protein (NBP1-88096PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GPER/GPR30 Antibody

  • CEPR
  • CEPRG-protein coupled receptor 30
  • Chemoattractant receptor-like 2
  • chemokine receptor-like 2
  • CMKRL2
  • CMKRL2MGC99678
  • constitutively expressed peptide-like receptor
  • DRY12
  • DRY12IL8-related receptor DRY12
  • FEG-1
  • FEG-1mER
  • Flow-induced endothelial G-protein coupled receptor 1
  • G protein-coupled estrogen receptor 1
  • G protein-coupled receptor 30
  • GPER
  • GPR30
  • GPR30GPCR-Br
  • G-protein coupled estrogen receptor 1
  • heptahelix receptor
  • LERGU2
  • leucine rich protein in GPR30 3'UTR
  • LyGPR
  • Lymphocyte-derived G-protein coupled receptor
  • Membrane estrogen receptor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GPER/GPR30 Antibody (NBP1-88096) (0)

There are no publications for GPER/GPR30 Antibody (NBP1-88096).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPER/GPR30 Antibody (NBP1-88096) (0)

There are no reviews for GPER/GPR30 Antibody (NBP1-88096). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPER/GPR30 Antibody (NBP1-88096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPER/GPR30 Products

Bioinformatics Tool for GPER/GPR30 Antibody (NBP1-88096)

Discover related pathways, diseases and genes to GPER/GPR30 Antibody (NBP1-88096). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPER/GPR30 Antibody (NBP1-88096)

Discover more about diseases related to GPER/GPR30 Antibody (NBP1-88096).

Pathways for GPER/GPR30 Antibody (NBP1-88096)

View related products by pathway.

PTMs for GPER/GPR30 Antibody (NBP1-88096)

Learn more about PTMs related to GPER/GPR30 Antibody (NBP1-88096).

Research Areas for GPER/GPR30 Antibody (NBP1-88096)

Find related products by research area.

Blogs on GPER/GPR30

There are no specific blogs for GPER/GPR30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPER/GPR30 Antibody and receive a gift card or discount.


Gene Symbol GPER