GP2 Antibody - BSA Free

Western Blot: GP2 Antibody [NBP1-59912] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: GP2 Antibody [NBP1-59912] - Staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Western Blot: GP2 Antibody [NBP1-59912] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Western Blot: GP2 Antibody [NBP1-59912] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that GP2 is expressed in HepG2

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GP2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GP2(glycoprotein 2 (zymogen granule membrane)) The peptide sequence was selected from the middle region of GP2. Peptide sequence SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GP2 Antibody - BSA Free

• DKFZp779K0533
• glycoprotein 2 (zymogen granule membrane)
• GP2
• pancreatic secretory granule membrane major glycoprotein GP2
• pancreatic zymogen granule membrane associated protein GP2
• Pancreatic zymogen granule membrane protein GP-2
• ZAP75

Background

GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GP2 Antibody (NBP1-59912)(1)

Publication using NBP1-59912

• Woodford C, Yin T, Chang HH, Regeenes R Nicotinamide promotes differentiation of pancreatic endocrine progenitors from human pluripotent stem cells through poly (ADP-ribose) polymerase inhibition bioRxiv 2020-01-01 (MCS, Human)

FAQs for GP2 Antibody (NBP1-59912). (Showing 1 - 1 of 1 FAQ).

1. The species list includes bovine. Has this cross reactivity been tested?
   • The bovine reactivity is listed on this antibody due to sequence homology. Based on the peptide sequence, the homology is 79%.

Bioinformatics

• Gene Symbol: GP2
• Uniprot:
  • P55259(Human)