GOLGB1/Giantin Antibody (6D4) - Azide and BSA Free

Sandwich ELISA: GOLGB1/Giantin Antibody (6D4) [H00002804-M01] - Detection limit for recombinant GST tagged GOLGB1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6D4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GOLGB1/Giantin Antibody (6D4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GOLGB1 (NP_004478, 3 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADN
• Marker: Golgi Apparatus Marker
• Specificity: GOLGB1 (6D4)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GOLGB1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GOLGB1/Giantin Antibody (6D4) - Azide and BSA Free

• 372 kDa Golgi complex-associated protein
• GCP
• GCP372
• GCP372GIANTIN
• Giantin
• GOLGB1
• golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal)1,macrogolgin
• golgi integral membrane protein 1
• golgin B1
• golgin B1, golgi integral membrane protein
• Golgin subfamily B member 1
• GOLIM1
• Macrogolgin

Background

The giantin (GOLGB1) gene codes for a golgin subfamily B member 1 protein that exists in isoform 1 at a length of 3,259 amino acids and a mass of 376 kDa or isoform 2 at 3,269 amino acids long and 377 kDA. GOLGB1 is thought to participate in the development of intercisternal cross-bridges of the Golgi complex. Researchers have investigated its role in hypertension, myopathy, hematopoiesis, encephalitis, and arthritis. GOLGB1 is known to interact with other genes such as PFN2, CAV2, USO1, SLC2A3, and GORASP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GOLGB1
• Entrez:
  • 2804(Human)
• OMIM:
  • 602500(Human)
• Uniprot:
  • NP_004478(Human)