GOLGA5 Antibody - BSA Free

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP2-39007] - Staining in human epididymis and skeletal muscle tissues using NBP2-39007 antibody. Corresponding GOLGA5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP2-39007] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP2-39007] - Staining of human cerebellum, epididymis, stomach and testis using Anti-GOLGA5 antibody NBP2-39007 (A) shows similar protein distribution across tissues to independent antibody NBP1-83352 (B).

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP2-39007] - Staining of human epididymis shows strong positivity in Golgi apparatus in glandular cells.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP2-39007] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP2-39007] - Staining of human stomach shows moderate to strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP2-39007] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GOLGA5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GOLGA5 Antibody - BSA Free (NBP2-39007) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNS
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOLGA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GOLGA5 Protein (NBP2-39007PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GOLGA5 Antibody - BSA Free

• Cell proliferation-inducing gene 31 protein
• golgi autoantigen, golgin subfamily a, 5
• golgin A5
• Golgin subfamily A member 5
• Golgin-84
• GOLIM5
• Protein Ret-II
• PTC5
• RET-fused gene 5 protein
• RETII
• ret-II
• rfg5
• RFG5golgi integral membrane protein 5

Background

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GOLGA5
• Uniprot:
  • Q8TBA6(Human)