OCRL Antibody

Images

 
Western Blot: OCRL Antibody [NBP1-80973] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-OCRL antibody. Remaining relative intensity is presented. Loading ...read more
Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human Fallopian tube shows moderate to strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human liver shows weak positivity in hepatocytes.
Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic and endothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OCRL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELY
Specificity
Specificity of human OCRL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCRL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
OCRL Knockout 293T Cell Lysate
Control Peptide
OCRL Protein (NBP1-80973PEP)
Publications
Read Publication using NBP1-80973.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OCRL Antibody

  • EC 3.1.3.36
  • INPP5F
  • LOCR
  • Lowe oculocerebrorenal syndrome protein
  • NPHL2
  • OCRL1inositol polyphosphate 5-phosphatase OCRL-1
  • oculocerebrorenal syndrome of Lowe
  • phosphatidylinositol polyphosphate 5-phosphatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31705
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-69123
Species: Mu, Rt
Applications: WB
NBP3-05081
Species: Hu, Rt
Applications: WB, ICC/IF
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
H00003636-M01
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, S-ELISA
NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-57739
Species: Hu
Applications: WB
NBP2-46536
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24716
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80973
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for OCRL Antibody (NBP1-80973)(1)

Reviews for OCRL Antibody (NBP1-80973) (0)

There are no reviews for OCRL Antibody (NBP1-80973). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCRL Antibody (NBP1-80973) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OCRL Products

Bioinformatics Tool for OCRL Antibody (NBP1-80973)

Discover related pathways, diseases and genes to OCRL Antibody (NBP1-80973). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCRL Antibody (NBP1-80973)

Discover more about diseases related to OCRL Antibody (NBP1-80973).
 

Pathways for OCRL Antibody (NBP1-80973)

View related products by pathway.

PTMs for OCRL Antibody (NBP1-80973)

Learn more about PTMs related to OCRL Antibody (NBP1-80973).
 

Research Areas for OCRL Antibody (NBP1-80973)

Find related products by research area.

Blogs on OCRL

There are no specific blogs for OCRL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OCRL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OCRL
Entrez
Uniprot