![Western Blot: OCRL Antibody [NBP1-80973] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-OCRL antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/OCRL-Antibody-Western-Blot-NBP1-80973-img0006.jpg "Western Blot: OCRL Antibody [NBP1-80973] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-OCRL antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, Mycoplasma |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELY |
| Predicted Species | Mouse (97%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OCRL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images2/SHIP_MAB2317_Western_Blot_6027.jpg)
![Immunocytochemistry SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images2/SHIP_MAB2317_Immunocytochemistry_9852.jpg)
![Knockout Validated SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images/mab2317_human-mouse-rat-ship-mab-clone-257812-20820241518568.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for OCRL Antibody (NBP1-80973)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/OCRL-Antibody-Immunohistochemistry-Paraffin-NBP1-80973-img0010.jpg "Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human Fallopian tube shows moderate to strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/OCRL-Antibody-Immunohistochemistry-Paraffin-NBP1-80973-img0007.jpg "Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human Fallopian tube shows moderate to strong cytoplasmic and membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human liver shows weak positivity in hepatocytes.](http://images.novusbio.com/fullsize/OCRL-Antibody-Immunohistochemistry-Paraffin-NBP1-80973-img0008.jpg "Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human liver shows weak positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic and endothelial cells.](http://images.novusbio.com/fullsize/OCRL-Antibody-Immunohistochemistry-Paraffin-NBP1-80973-img0009.jpg "Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic and endothelial cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")