GnRH Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GnRH Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNRH1.
  
  

  Source: E. coli

  Amino Acid Sequence: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GNRH1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89749.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GnRH Recombinant Protein Antigen

• GNRH
• GnRH-associated peptide 1
• gonadotropin-releasing hormone 1 (leutinizing-releasing hormone)
• gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
• GRH
• LHRH
• LNRH
• luliberin I
• Progonadoliberin I
• progonadoliberin-1
• prolactin release-inhibiting factor

Background

Gonadotropin releasing hormone (GnRH), also known as luteinizing hormone releasing hormone (LHRH), is a key molecule in the regulation of reproduction in vertebrates. GnRH, a decapeptide, is produced by neurons in the medial basal hypothalamus (MBH) and secreted in a pulsatile manner into the cardiovascular system. The frequency and amplitude of GnRH pulses determine secretion of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary. Higher frequencies (greater than one pulse per hour) stimulate LH secretion while lower frequencies stimulate FSH secretion. The generation of GnRH pulses is effected by numerous stimuli, such as neural, hormonal and environmental. Therefore, behavioral and physiological conditions such as sleep, exercise, and stress can affect the GnRH pulses and cause a disruption of the normal cycle.Recent studies show that GnRH also has a role in mediating cancer. GnRH has been shown to inhibit the growth of human uterine leiomyloma cells by suppressing proliferation and inducing apoptosis. GnRH analogs have been used to treat a wide variety of reproductive cancers, although the side effects of using such compounds are often quite severe.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GNRH1