GnRH Antibody [Alexa Fluor® 750]

Images

 

Product Details

Summary
Product Discontinued
View other related GnRH Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38172AF750
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GnRH Antibody [Alexa Fluor® 750] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human GnRH (NP_001076580.1).

Sequence:
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNRH1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for GnRH Antibody [Alexa Fluor® 750]

  • GNRH
  • GnRH-associated peptide 1
  • gonadotropin-releasing hormone 1 (leutinizing-releasing hormone)
  • gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
  • GRH
  • LHRH
  • LNRH
  • luliberin I
  • Progonadoliberin I
  • progonadoliberin-1
  • prolactin release-inhibiting factor

Background

Gonadotropin releasing hormone (GnRH), also known as luteinizing hormone releasing hormone (LHRH), is a key molecule in the regulation of reproduction in vertebrates. GnRH, a decapeptide, is produced by neurons in the medial basal hypothalamus (MBH) and secreted in a pulsatile manner into the cardiovascular system. The frequency and amplitude of GnRH pulses determine secretion of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary. Higher frequencies (greater than one pulse per hour) stimulate LH secretion while lower frequencies stimulate FSH secretion. The generation of GnRH pulses is effected by numerous stimuli, such as neural, hormonal and environmental. Therefore, behavioral and physiological conditions such as sleep, exercise, and stress can affect the GnRH pulses and cause a disruption of the normal cycle.Recent studies show that GnRH also has a role in mediating cancer. GnRH has been shown to inhibit the growth of human uterine leiomyloma cells by suppressing proliferation and inducing apoptosis. GnRH analogs have been used to treat a wide variety of reproductive cancers, although the side effects of using such compounds are often quite severe.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP2-34014
Species: Hu
Applications: IHC,  IHC-P
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC,  IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NBP3-04850
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-38172AF750
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for GnRH Antibody (NBP3-38172AF750) (0)

There are no publications for GnRH Antibody (NBP3-38172AF750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GnRH Antibody (NBP3-38172AF750) (0)

There are no reviews for GnRH Antibody (NBP3-38172AF750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GnRH Antibody (NBP3-38172AF750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GnRH Products

Research Areas for GnRH Antibody (NBP3-38172AF750)

Find related products by research area.

Blogs on GnRH.

The Use of RNA Polymerase II Antibodies In Proteasome Regulation Studies
At Novus Biologicals, we recently added a new RNA Polymerase II antibody (clone 4H8) to our antibody catalog. RNAPII is an essential transcription enzyme, catalyzing the transcription of DNA during the elongation stage of mRNA synthesis (known as the ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GnRH Antibody [Alexa Fluor® 750] and receive a gift card or discount.

Bioinformatics

Gene Symbol GNRH1