GMPS Antibody

Images

 
Western Blot: GMPS Antibody [NBP1-52972] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GMPS Antibody Summary

Immunogen
Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GMPS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GMPS and was validated on Western blot.
Theoretical MW
77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GMPS Antibody

  • EC 6.3.5.2
  • Glutamine amidotransferase
  • GMP synthase [glutamine-hydrolyzing]
  • GMP synthase
  • GMP synthetase
  • guanine monphosphate synthetase
  • guanosine 5'-monophosphate synthase
  • MLL/GMPS fusion protein

Background

In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP.In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-86847
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
AF6014
Species: Hu, Mu, Rt
Applications: WB
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NB100-513
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52972
Species: Hu
Applications: WB

Publications for GMPS Antibody (NBP1-52972) (0)

There are no publications for GMPS Antibody (NBP1-52972).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMPS Antibody (NBP1-52972) (0)

There are no reviews for GMPS Antibody (NBP1-52972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GMPS Antibody (NBP1-52972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GMPS Products

Bioinformatics Tool for GMPS Antibody (NBP1-52972)

Discover related pathways, diseases and genes to GMPS Antibody (NBP1-52972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMPS Antibody (NBP1-52972)

Discover more about diseases related to GMPS Antibody (NBP1-52972).
 

Pathways for GMPS Antibody (NBP1-52972)

View related products by pathway.

PTMs for GMPS Antibody (NBP1-52972)

Learn more about PTMs related to GMPS Antibody (NBP1-52972).

Blogs on GMPS

There are no specific blogs for GMPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GMPS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GMPS
Uniprot