GMPR2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GMPR2 Antibody [NBP2-57445] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GMPR2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTSCLPALRFIATPRLSAMPHIDNDVKLDFKD
Specificity
Specificity of human GMPR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GMPR2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GMPR2 Antibody

  • EC 1.7.1.7
  • GMP reductase 2
  • Guanosine 5'-monophosphate oxidoreductase 2
  • guanosine monophosphate reductase 2MGC830
  • guanosine monophosphate reductase isolog
  • MGC15084

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87459
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8554
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67334
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
AF7287
Species: Hu, Mu
Applications: WB, IHC
NBP1-86177
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-65538
Species: Hu
NBP1-85599
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD

Publications for GMPR2 Antibody (NBP2-57445) (0)

There are no publications for GMPR2 Antibody (NBP2-57445).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMPR2 Antibody (NBP2-57445) (0)

There are no reviews for GMPR2 Antibody (NBP2-57445). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GMPR2 Antibody (NBP2-57445) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GMPR2 Products

Bioinformatics Tool for GMPR2 Antibody (NBP2-57445)

Discover related pathways, diseases and genes to GMPR2 Antibody (NBP2-57445). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMPR2 Antibody (NBP2-57445)

Discover more about diseases related to GMPR2 Antibody (NBP2-57445).
 

Pathways for GMPR2 Antibody (NBP2-57445)

View related products by pathway.

PTMs for GMPR2 Antibody (NBP2-57445)

Learn more about PTMs related to GMPR2 Antibody (NBP2-57445).

Blogs on GMPR2

There are no specific blogs for GMPR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GMPR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GMPR2