GMPR1 Antibody

Images

 
Western Blot: GMPR1 Antibody [NBP1-87459] - Analysis in control (vector only transfected HEK293T lysate) and GMPR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: GMPR1 Antibody [NBP1-87459] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GMPR1 Antibody [NBP1-87459] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: GMPR1 Antibody [NBP1-87459] - Staining of human prostate shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GMPR1 Antibody [NBP1-87459] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GMPR1 Antibody [NBP1-87459] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: GMPR1 Antibody [NBP1-87459] - Staining of human malignant melanoma shows moderate cytoplasmic positivity in tumor cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GMPR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYS
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GMPR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 24139804). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GMPR1 Protein (NBP1-87459PEP)
Publications
Read Publication using
NBP1-87459 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%). Human reactivity reported in scientific literature (PMID: 24139804).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GMPR1 Antibody

  • EC 1.7.1.7
  • GMPR1GMP reductase 1
  • guanine monophosphate reductase
  • Guanosine 5'-monophosphate oxidoreductase 1
  • Guanosine monophosphate reductase 1
  • guanosine monophosphate reductase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86183
Species: Hu
Applications: IHC, IHC-P, WB
AF3667
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
DC140
Species: Hu
Applications: ELISA
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-92503
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
MAB7020
Species: Hu
Applications: IHC, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-46069
Species: Hu, Mu, Rt
Applications: WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-75541
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81898
Species: Hu
Applications: IHC, IHC-P

Publications for GMPR1 Antibody (NBP1-87459)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GMPR1 Antibody (NBP1-87459) (0)

There are no reviews for GMPR1 Antibody (NBP1-87459). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GMPR1 Antibody (NBP1-87459) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GMPR1 Products

Bioinformatics Tool for GMPR1 Antibody (NBP1-87459)

Discover related pathways, diseases and genes to GMPR1 Antibody (NBP1-87459). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMPR1 Antibody (NBP1-87459)

Discover more about diseases related to GMPR1 Antibody (NBP1-87459).

Research Areas for GMPR1 Antibody (NBP1-87459)

Find related products by research area.

Blogs on GMPR1

There are no specific blogs for GMPR1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GMPR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GMPR