GMPR1 Antibody


Western Blot: GMPR1 Antibody [NBP1-87459] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunohistochemistry-Paraffin: GMPR1 Antibody [NBP1-87459] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GMPR1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYS
Specificity of human GMPR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GMPR1 Protein (NBP1-87459PEP)
Read Publication using
NBP1-87459 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%). Human reactivity reported in scientific literature (PMID: 24139804).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GMPR1 Antibody

  • EC
  • GMPR1GMP reductase 1
  • guanine monophosphate reductase
  • Guanosine 5'-monophosphate oxidoreductase 1
  • Guanosine monophosphate reductase 1
  • guanosine monophosphate reductase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for GMPR1 Antibody (NBP1-87459)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for GMPR1 Antibody (NBP1-87459) (0)

There are no reviews for GMPR1 Antibody (NBP1-87459). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GMPR1 Antibody (NBP1-87459) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GMPR1 Products

Bioinformatics Tool for GMPR1 Antibody (NBP1-87459)

Discover related pathways, diseases and genes to GMPR1 Antibody (NBP1-87459). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMPR1 Antibody (NBP1-87459)

Discover more about diseases related to GMPR1 Antibody (NBP1-87459).

Blogs on GMPR1

There are no specific blogs for GMPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GMPR1 Antibody and receive a gift card or discount.


Gene Symbol GMPR