Glypican 5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glypican 5 Antibody [NBP2-48723] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry: Glypican 5 Antibody [NBP2-48723] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells, subset of glial cells and neuropil displays strong cytoplasmic staining while endothelial cells are moderately stained.

Immunohistochemistry-Paraffin: Glypican 5 Antibody [NBP2-48723] - Staining in human cerebral cortex and pancreas tissues using anti-GPC5 antibody. Corresponding GPC5 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glypican 5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glypican 5 Antibody - BSA Free (NBP2-48723) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AELNPHWHAYIRSLEELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVRTPTQSPRCSFDQSKEKHGMKTTTRN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPC5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glypican 5 Recombinant Protein Antigen (NBP2-48723PEP)

Reactivity Notes

Mouse (88%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glypican 5 Antibody - BSA Free

• bA93M14.1
• Glypican 5
• glypican proteoglycan 5
• glypican-5
• GPC5

Background

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPC5