Glypican 3 Recombinant Protein Antigen

Images

 
There are currently no images for Glypican 3 Protein (NBP1-85226PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glypican 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPC3.

Source: E. coli

Amino Acid Sequence: DKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85226.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glypican 3 Recombinant Protein Antigen

  • DGSX
  • Glypican 3
  • glypican proteoglycan 3
  • glypican-3
  • GPC3
  • GTR2-2
  • heparan sulphate proteoglycan
  • Intestinal protein OCI-5
  • MXR7
  • OCI5
  • OCI-5
  • secreted glypican-3
  • SGB
  • SGBS
  • SGBS1SDYS

Background

The Glypican 3 (GPC3) gene encodes for a member of the glypican-related integral membrane proteoglycan family (GRIPS). Two isoforms of the protein exist, isoform 1 at a length of 580 amino acids long and 65 kDA while isoform 2 is 526 amino acids long at 59 kDA. The protein encoded by GPC3 is thought to prevent the dipeptidyl peptidase activity of DPP4 and may participate in the suppression and regulation of growth in the predominately mesodermal tissues and organs. The GPC3 gene participates in the Wnt signaling pathway, metabolism, and visual phototransduction through interactions with genes FGF2, WNT3A, WNT7B, BCAN, and BGN. GPC3 has been researched in various diseases such as paine syndrome, horner's sundrome, liver cirrhosis, simpson-golabi-behmel syndrome, germ cell tumors, wilms tumors, complex regional pain syndrome, and hepatocellulcar carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
MAB2965
Species: Hu
Applications: CyTOF-ready, Flow
AF2364
Species: Hu
Applications: IHC, WB
NBP1-83910
Species: Hu
Applications: IHC,  IHC-P, KD, WB
AF4519
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-13980
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
292-G2
Species: Hu
Applications: BA
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
233-FB
Species: Hu
Applications: BA
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP1-87697
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-687
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-85226PEP
Species: Hu
Applications: AC

Publications for Glypican 3 Protein (NBP1-85226PEP) (0)

There are no publications for Glypican 3 Protein (NBP1-85226PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glypican 3 Protein (NBP1-85226PEP) (0)

There are no reviews for Glypican 3 Protein (NBP1-85226PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glypican 3 Protein (NBP1-85226PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glypican 3 Products

Research Areas for Glypican 3 Protein (NBP1-85226PEP)

Find related products by research area.

Blogs on Glypican 3.

Glypican 3 as a biomarker for gastro-esophageal adenocarcinoma
By Jamshed Arslan, Pharm. D., PhD. Gastroesophageal adenocarcinoma originates from the glandular epithelium of the esophagus, gastroesophageal junction and stomach. The incidence of gastroesophageal adenocarcinoma is ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glypican 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPC3