Glycogen Synthase Antibody (8N1B3)

Western Blot: Glycogen Synthase Antibody (8N1B3) [NBP3-16719] - Western blot analysis of extracts of various cell lines, using Glycogen synthase 1 (Glycogen Synthase) Rabbit mAb (NBP3-16719) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 8N1B3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Glycogen Synthase Antibody (8N1B3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 638-737 of human Glycogen synthase (P13807). RPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GYS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 -1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glycogen Synthase Antibody (8N1B3)

• EC 2.4.1.11
• glycogen [starch] synthase, muscle
• glycogen synthase 1 (muscle)
• GYSGSY

Background

Glycogen synthase is an enzyme of the transferase class that catalyses the reaction of UDP-glucose and (1,4-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GYS1