Glycogen synthase 2 Antibody

Western Blot: Glycogen synthase 2 Antibody [NBP1-91191] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunohistochemistry-Paraffin: Glycogen synthase 2 Antibody [NBP1-91191] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Glycogen synthase 2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GYS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glycogen synthase 2 Protein (NBP1-91191PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%), Mouse (89%). Reactivity reported in scientific literature (PMID: 23436904)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glycogen synthase 2 Antibody

• EC 2.4.1.11
• glycogen [starch] synthase, liver
• glycogen synthase 2 (liver)

Background

The protein encoded by the Glycogen synthase 2 gene, liver glycogen synthase, catalyzes the rate-limiting step in the synthesis ofglycogen - the transfer of a glucose molecule from UDP-glucose to a terminal branch of the glycogen molecule.Mutations in this gene cause glycogen storage disease type 0 (GSD-0) - a rare type of early childhood fastinghypoglycemia with decreased liver glycogen content. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glycogen synthase 2 Antibody (NBP1-91191)(1)

Publication using NBP1-91191

• Geiger T, Velic A, Macek B et al. Initial Quantitative Proteomic Map of 28 Mouse Tissues Using the SILAC Mouse. Mol Cell Proteomics 2013-06-01 [PMID: 23436904]

Bioinformatics

• Gene Symbol: GYS2