Glycogen synthase 2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GYS2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%), Mouse (89%). Reactivity reported in scientific literature (PMID: 23436904)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Glycogen synthase 2 Antibody
Background
The protein encoded by the Glycogen synthase 2 gene, liver glycogen synthase, catalyzes the rate-limiting step in the synthesis ofglycogen - the transfer of a glucose molecule from UDP-glucose to a terminal branch of the glycogen molecule.Mutations in this gene cause glycogen storage disease type 0 (GSD-0) - a rare type of early childhood fastinghypoglycemia with decreased liver glycogen content. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, NULL, SignalStim, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: PAGE, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Glycogen synthase 2 Antibody (NBP1-91191)(1)
Showing Publication 1 -
1 of 1.
Reviews for Glycogen synthase 2 Antibody (NBP1-91191) (0)
There are no reviews for Glycogen synthase 2 Antibody (NBP1-91191).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glycogen synthase 2 Antibody (NBP1-91191) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glycogen synthase 2 Products
Bioinformatics Tool for Glycogen synthase 2 Antibody (NBP1-91191)
Discover related pathways, diseases and genes to Glycogen synthase 2 Antibody (NBP1-91191). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Glycogen synthase 2 Antibody (NBP1-91191)
Discover more about diseases related to Glycogen synthase 2 Antibody (NBP1-91191).
| | Pathways for Glycogen synthase 2 Antibody (NBP1-91191)
View related products by pathway.
|
PTMs for Glycogen synthase 2 Antibody (NBP1-91191)
Learn more about PTMs related to Glycogen synthase 2 Antibody (NBP1-91191).
| | Research Areas for Glycogen synthase 2 Antibody (NBP1-91191)
Find related products by research area.
|
Blogs on Glycogen synthase 2