glycerol-3-phosphate permease Antibody


Immunocytochemistry/ Immunofluorescence: glycerol-3-phosphate permease Antibody [NBP1-87524] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: glycerol-3-phosphate permease Antibody [NBP1-87524] - Staining of human duodenum shows strong granular positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

glycerol-3-phosphate permease Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNY
Specificity of human glycerol-3-phosphate permease antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
glycerol-3-phosphate permease Protein (NBP1-87524PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for glycerol-3-phosphate permease Antibody

  • FLJ22340
  • G-3-P permease
  • G-3-P transporter
  • G3PPgene similar to glycerol-3-phosphate permease10Glycerol-3-phosphate permease
  • glycerol-3-phosphate transporter
  • solute carrier family 37 (glycerol-3-phosphate transporter), member 1
  • Solute carrier family 37 member 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ICC/IF

Publications for glycerol-3-phosphate permease Antibody (NBP1-87524) (0)

There are no publications for glycerol-3-phosphate permease Antibody (NBP1-87524).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for glycerol-3-phosphate permease Antibody (NBP1-87524) (0)

There are no reviews for glycerol-3-phosphate permease Antibody (NBP1-87524). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for glycerol-3-phosphate permease Antibody (NBP1-87524) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional glycerol-3-phosphate permease Products

Bioinformatics Tool for glycerol-3-phosphate permease Antibody (NBP1-87524)

Discover related pathways, diseases and genes to glycerol-3-phosphate permease Antibody (NBP1-87524). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for glycerol-3-phosphate permease Antibody (NBP1-87524)

Discover more about diseases related to glycerol-3-phosphate permease Antibody (NBP1-87524).

Pathways for glycerol-3-phosphate permease Antibody (NBP1-87524)

View related products by pathway.

Blogs on glycerol-3-phosphate permease

There are no specific blogs for glycerol-3-phosphate permease, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our glycerol-3-phosphate permease Antibody and receive a gift card or discount.


Gene Symbol SLC37A1