glycerol-3-phosphate permease Antibody

Images

 
Western Blot: glycerol-3-phosphate permease Antibody [NBP1-69300] - This Anti-SLC37A1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

glycerol-3-phosphate permease Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC37A1(solute carrier family 37 (glycerol-3-phosphate transporter), member 1) The peptide sequence was selected from the middle region of SLC37A1 (NP_061837). Peptide sequence LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC37A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for glycerol-3-phosphate permease Antibody

  • FLJ22340
  • G-3-P permease
  • G-3-P transporter
  • G3PPgene similar to glycerol-3-phosphate permease10Glycerol-3-phosphate permease
  • glycerol-3-phosphate transporter
  • solute carrier family 37 (glycerol-3-phosphate transporter), member 1
  • Solute carrier family 37 member 1

Background

SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06603
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-57033
Species: Hu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-31972
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF972
Species: Hu
Applications: WB, Simple Western, IHC
H00064699-M01
Species: Hu
Applications: WB, ELISA
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77132
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24689
Species: Hu, Mu
Applications: WB
NBP2-57417
Species: Hu
Applications: WB, ICC/IF

Publications for glycerol-3-phosphate permease Antibody (NBP1-69300) (0)

There are no publications for glycerol-3-phosphate permease Antibody (NBP1-69300).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for glycerol-3-phosphate permease Antibody (NBP1-69300) (0)

There are no reviews for glycerol-3-phosphate permease Antibody (NBP1-69300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for glycerol-3-phosphate permease Antibody (NBP1-69300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional glycerol-3-phosphate permease Products

Bioinformatics Tool for glycerol-3-phosphate permease Antibody (NBP1-69300)

Discover related pathways, diseases and genes to glycerol-3-phosphate permease Antibody (NBP1-69300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for glycerol-3-phosphate permease Antibody (NBP1-69300)

Discover more about diseases related to glycerol-3-phosphate permease Antibody (NBP1-69300).
 

Pathways for glycerol-3-phosphate permease Antibody (NBP1-69300)

View related products by pathway.

Blogs on glycerol-3-phosphate permease

There are no specific blogs for glycerol-3-phosphate permease, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our glycerol-3-phosphate permease Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC37A1
Entrez
Uniprot