Glutathione Synthetase Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-57177] - Staining in human epididymis and pancreas tissues using anti-GSS antibody. Corresponding GSS RNA-seq data are more
Independent Antibodies: Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-57177] - Staining of human cerebral cortex, colon, epididymis and testis using Anti-GSS antibody NBP2-57177 (A) shows more
Independent Antibodies: Western Blot: Glutathione Synthetase Antibody [NBP2-57177] - Analysis using Anti-GSS antibody NBP2-57177 (A) shows similar pattern to independent antibody NBP2-30465 (B).
Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody [NBP2-57177] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-57177] - Staining of human testis.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-57177] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-57177] - Staining of human colon.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-57177] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-57177] - Staining of human epididymis using Anti-GSS antibody NBP2-57177.

Product Details

Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P

Order Details

Glutathione Synthetase Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQQELSRPGMLEMLLPG
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:10
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Simple Western referenced in scientific literature (PMID: 32026202).
Control Peptide
Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP)
Read Publication using
NBP2-57177 in the following applications:

Reactivity Notes

Mouse (82%), Rat (83%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Glutathione Synthetase Antibody

  • EC
  • Glutathione synthase
  • glutathione synthetase
  • GSH synthetase
  • GSHS
  • GSH-S
  • MGC14098


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P

Publications for Glutathione Synthetase Antibody (NBP2-57177)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: Simple Western.

Filter By Application
Simple Western
All Applications
Filter By Species
All Species

Reviews for Glutathione Synthetase Antibody (NBP2-57177) (0)

There are no reviews for Glutathione Synthetase Antibody (NBP2-57177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutathione Synthetase Antibody (NBP2-57177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Glutathione Synthetase Products

Bioinformatics Tool for Glutathione Synthetase Antibody (NBP2-57177)

Discover related pathways, diseases and genes to Glutathione Synthetase Antibody (NBP2-57177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione Synthetase Antibody (NBP2-57177)

Discover more about diseases related to Glutathione Synthetase Antibody (NBP2-57177).

Pathways for Glutathione Synthetase Antibody (NBP2-57177)

View related products by pathway.

PTMs for Glutathione Synthetase Antibody (NBP2-57177)

Learn more about PTMs related to Glutathione Synthetase Antibody (NBP2-57177).

Research Areas for Glutathione Synthetase Antibody (NBP2-57177)

Find related products by research area.

Blogs on Glutathione Synthetase

There are no specific blogs for Glutathione Synthetase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glutathione Synthetase Antibody and receive a gift card or discount.


Gene Symbol GSS