Glutathione S Transferase kappa 1 Antibody


Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining in human small intestine and pancreas tissues using anti-GSTK1 antibody. Corresponding GSTK1 RNA-seq data are presented more
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human small intestine shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Glutathione S Transferase kappa 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVN
Specificity of human Glutathione S Transferase kappa 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Glutathione S Transferase kappa 1 Lysate (NBP2-65515)
Control Peptide
Glutathione S Transferase kappa 1 Protein (NBP1-89727PEP)
Read Publication using NBP1-89727.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Glutathione S Transferase kappa 1 Antibody

  • EC
  • glutathione S-transferase k1
  • glutathione S-transferase kappa 1
  • glutathione S-transferase subunit 13 homolog
  • Glutathione S-transferase subunit 13
  • GST 13-13
  • GST class-kappa
  • GST
  • GST13
  • GST13-13
  • GSTK1-1
  • hGSTK1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ye
Applications: WB
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)(1)

Reviews for Glutathione S Transferase kappa 1 Antibody (NBP1-89727) (0)

There are no reviews for Glutathione S Transferase kappa 1 Antibody (NBP1-89727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutathione S Transferase kappa 1 Antibody (NBP1-89727). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for the antibody that recognizes protein, GSH transferase kappa from bovine.
    • The immunogen for NBP1-89727 shares 90% similarity with bovine GSTK1, so is predicted to cross-react. The immunogen for NBP1-57752 shares 88% similarity with bovine GSTK1, so is predicted to cross-react. I am not sure what application you are looking to use this in. If you are looking at Western blot, either antibody would work. If you are looking at any tissue staining, then I would recommend NBP1-89727. While we cannot guarantee this antibody for use in bovine samples, if you would be interested in testing this novel species, please take a look at our Innovator's Reward program.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)

Discover related pathways, diseases and genes to Glutathione S Transferase kappa 1 Antibody (NBP1-89727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)

Discover more about diseases related to Glutathione S Transferase kappa 1 Antibody (NBP1-89727).

Pathways for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)

View related products by pathway.

PTMs for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)

Learn more about PTMs related to Glutathione S Transferase kappa 1 Antibody (NBP1-89727).

Blogs on Glutathione S Transferase kappa 1

There are no specific blogs for Glutathione S Transferase kappa 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glutathione S Transferase kappa 1 Antibody and receive a gift card or discount.


Gene Symbol GSTK1