Glutathione S Transferase kappa 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Analysis in human duodenum and pancreas tissues using NBP1-89727 antibody. Corresponding Glutathione S Transferase kappa 1 RNA-seq data are presented for the same tissues.

Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Staining of human pancreas shows weak granular cytoplasmic positivity in islets of Langerhans as ecxpected.

Staining of human skeletal muscle shows weak granular cytoplasmic positivity in myocytes as expected.

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glutathione S Transferase kappa 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glutathione S Transferase kappa 1 Antibody - BSA Free (NBP1-89727) is a polyclonal antibody validated for use in IHC. Anti-Glutathione S Transferase kappa 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSTK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glutathione S Transferase kappa 1 Protein (NBP1-89727PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glutathione S Transferase kappa 1 Antibody - BSA Free

• EC 2.5.1.18
• glutathione S-transferase k1
• glutathione S-transferase kappa 1
• glutathione S-transferase subunit 13 homolog
• Glutathione S-transferase subunit 13
• GST 13-13
• GST class-kappa
• GST
• GST13
• GST13-13
• GSTK1-1
• hGSTK1

Background

Glutathione transferases (GSTs) are a superfamily of enzymes that play a vital functional role in the cellular detoxification process. They catalyze the conjugation of the thiol group of glutathione (GSH) to the electrophilic groups of a wide range of hydrophobic substrates, leading to an easier removal of the latter from the cells (1) The Kappa class of GSTs comprises soluble enzymes originally isolated from the mitochondrial matrix of rats. Gsk1 catalyses some typical GST reactions, it has been proposed that it is structurally distinct from other classes of cytosolic GSTs (2). Gsk1 has been identified in rat, mouse, and human. The C terminus of Gsk1 was essential for localization of the protein to peroxisomes, and the C-terminal sequence Ala-Arg-Leu represents a peroxisome targeting signal (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)(1)

Publication using NBP1-89727

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

FAQs for Glutathione S Transferase kappa 1 Antibody (NBP1-89727). (Showing 1 - 1 of 1 FAQ).

1. I am looking for the antibody that recognizes protein, GSH transferase kappa from bovine.
   • The immunogen for NBP1-89727 shares 90% similarity with bovine GSTK1, so is predicted to cross-react. The immunogen for NBP1-57752 shares 88% similarity with bovine GSTK1, so is predicted to cross-react. I am not sure what application you are looking to use this in. If you are looking at Western blot, either antibody would work. If you are looking at any tissue staining, then I would recommend NBP1-89727. While we cannot guarantee this antibody for use in bovine samples, if you would be interested in testing this novel species, please take a look at our Innovator's Reward program.

Bioinformatics

• Gene Symbol: GSTK1