Glutathione S Transferase kappa 1 Antibody

Images

 
Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutathione S Transferase kappa 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glutathione S Transferase kappa 1 Protein (NBP1-89727PEP)
Publications
Read Publication using NBP1-89727.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glutathione S Transferase kappa 1 Antibody

  • EC 2.5.1.18
  • glutathione S-transferase k1
  • glutathione S-transferase kappa 1
  • glutathione S-transferase subunit 13 homolog
  • Glutathione S-transferase subunit 13
  • GST 13-13
  • GST class-kappa
  • GST
  • GST13
  • GST13-13
  • GSTK1-1
  • hGSTK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61572
Species: Hu, Bv, Pm
Applications: WB
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)(1)

Reviews for Glutathione S Transferase kappa 1 Antibody (NBP1-89727) (0)

There are no reviews for Glutathione S Transferase kappa 1 Antibody (NBP1-89727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutathione S Transferase kappa 1 Antibody (NBP1-89727). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for the antibody that recognizes protein, GSH transferase kappa from bovine.
    • The immunogen for NBP1-89727 shares 90% similarity with bovine GSTK1, so is predicted to cross-react. The immunogen for NBP1-57752 shares 88% similarity with bovine GSTK1, so is predicted to cross-react. I am not sure what application you are looking to use this in. If you are looking at Western blot, either antibody would work. If you are looking at any tissue staining, then I would recommend NBP1-89727. While we cannot guarantee this antibody for use in bovine samples, if you would be interested in testing this novel species, please take a look at our Innovator's Reward program.

Secondary Antibodies

 

Isotype Controls

Additional Glutathione S Transferase kappa 1 Products

Bioinformatics Tool for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)

Discover related pathways, diseases and genes to Glutathione S Transferase kappa 1 Antibody (NBP1-89727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)

Discover more about diseases related to Glutathione S Transferase kappa 1 Antibody (NBP1-89727).
 

Pathways for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)

View related products by pathway.

PTMs for Glutathione S Transferase kappa 1 Antibody (NBP1-89727)

Learn more about PTMs related to Glutathione S Transferase kappa 1 Antibody (NBP1-89727).

Blogs on Glutathione S Transferase kappa 1

There are no specific blogs for Glutathione S Transferase kappa 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutathione S Transferase kappa 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTK1