Glutamate Dehydrogenase Antibody

Images

 
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human brain cortex.
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human Fetal Liver Lysate, concentration 1ug/ml.
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - lanes 5: rat kidney cordex lanes 6: rat kidney proximal tubules prepped from cortex lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate lanes ...read more
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Tissue: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide ...read more
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: 293T Antibody Dilution: 1.0 ug/ml GLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human pancreas tissue.
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human kidney, renal tubular epithelium in cortex.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Glutamate Dehydrogenase Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to GLUD1(glutamate dehydrogenase 1) The peptide sequence was selected from the N terminal of GLUD1 (NP_005262). Peptide sequence: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER. The peptide sequence for this immunogen was taken from within the described region.
Marker
Mitochondria Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLUD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Glutamate Dehydrogenase Antibody

  • EC 1.4.1
  • EC 1.4.1.3
  • GDH 1
  • GDH
  • GDH1
  • GLUD
  • glutamate dehydrogenase (NAD(P)+)
  • Glutamate Dehydrogenase 1
  • glutamate dehydrogenase 1, mitochondrial
  • MGC132003

Background

L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glutamate Dehydrogenase Antibody (NBP1-54962) (0)

There are no publications for Glutamate Dehydrogenase Antibody (NBP1-54962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutamate Dehydrogenase Antibody (NBP1-54962) (0)

There are no reviews for Glutamate Dehydrogenase Antibody (NBP1-54962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutamate Dehydrogenase Antibody (NBP1-54962) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutamate Dehydrogenase Products

Research Areas for Glutamate Dehydrogenase Antibody (NBP1-54962)

Find related products by research area.

Blogs on Glutamate Dehydrogenase

There are no specific blogs for Glutamate Dehydrogenase, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutamate Dehydrogenase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLUD1
Entrez
Uniprot