Glutamate Dehydrogenase Antibody

Images

 
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54961] - lanes 5: rat kidney cordex lanes 6: rat kidney proximal tubules prepped from cortex lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate lanes ...read more
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54961] - Human pancreas tissue
Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54961] - HT1080 cell lysate, concentration 1ug/ml.
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54961] - Human colon tissue.
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54961] - Human kidney, renal tubular epithelium in cortex.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutamate Dehydrogenase Antibody Summary

Immunogen
Synthetic peptides corresponding to GLUD1(glutamate dehydrogenase 1) The peptide sequence was selected from the N terminal of GLUD1. Peptide sequence EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF.
Marker
Mitochondria Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLUD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against GLUD1 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-54961 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glutamate Dehydrogenase Antibody

  • EC 1.4.1
  • EC 1.4.1.3
  • GDH 1
  • GDH
  • GDH1
  • GLUD
  • glutamate dehydrogenase (NAD(P)+)
  • Glutamate Dehydrogenase 1
  • glutamate dehydrogenase 1, mitochondrial
  • MGC132003

Background

L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification. L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB8027
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP1-46489
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-33144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt, Bv, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-89766
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP

Publications for Glutamate Dehydrogenase Antibody (NBP1-54961)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Glutamate Dehydrogenase Antibody (NBP1-54961) (0)

There are no reviews for Glutamate Dehydrogenase Antibody (NBP1-54961). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutamate Dehydrogenase Antibody (NBP1-54961) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutamate Dehydrogenase Products

Bioinformatics Tool for Glutamate Dehydrogenase Antibody (NBP1-54961)

Discover related pathways, diseases and genes to Glutamate Dehydrogenase Antibody (NBP1-54961). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutamate Dehydrogenase Antibody (NBP1-54961)

Discover more about diseases related to Glutamate Dehydrogenase Antibody (NBP1-54961).
 

Pathways for Glutamate Dehydrogenase Antibody (NBP1-54961)

View related products by pathway.

PTMs for Glutamate Dehydrogenase Antibody (NBP1-54961)

Learn more about PTMs related to Glutamate Dehydrogenase Antibody (NBP1-54961).
 

Research Areas for Glutamate Dehydrogenase Antibody (NBP1-54961)

Find related products by research area.

Blogs on Glutamate Dehydrogenase

There are no specific blogs for Glutamate Dehydrogenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutamate Dehydrogenase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLUD1
Uniprot