Biological Strategies: Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54961] - The results of western blotting and RT-PCR assayA. shows Western blotting results, where the PDHA1 protein expression in the ...read more
Immunohistochemistry: Glutamate Dehydrogenase Antibody [NBP1-54961] - GLS1 and GLUD1 (Glutamate Dehydrogenase) are over-expressed in prostate cancers and associated with poor survival. Immunohistochemical staining of ...read more
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to GLUD1(glutamate dehydrogenase 1) The peptide sequence was selected from the N terminal of GLUD1. Peptide sequence EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF. The peptide sequence for this immunogen was taken from within the described region.
Marker
Mitochondria Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLUD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-54961 in the following applications:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for Glutamate Dehydrogenase Antibody - BSA Free
EC 1.4.1
EC 1.4.1.3
GDH 1
GDH
GDH1
GLUD
glutamate dehydrogenase (NAD(P)+)
Glutamate Dehydrogenase 1
glutamate dehydrogenase 1, mitochondrial
MGC132003
Background
L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification. L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Glutamate Dehydrogenase Antibody (NBP1-54961) (0)
There are no reviews for Glutamate Dehydrogenase Antibody (NBP1-54961).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Glutamate Dehydrogenase Antibody - BSA Free and receive a gift card or discount.