Glutamate Dehydrogenase Antibody (7L7N2) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 459-558 of human Glutamate Dehydrogenase (P00367). ERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
GLUD1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Glutamate Dehydrogenase Antibody (7L7N2)
Background
One enzyme central to the metabolism of glutamate is glutamate dehydrogenase (GDH1; EC 1.4.1.3), that catalyzes the reversible deamination of L-glutamate to 2-oxoglutarate using NAD+ or NADP+. Mammalian GDH is composed of six identical subunits, and the regulation of GDH is very complex. It has been a major goal to identify the substrate and regulatory binding sites of GDH. It is only in recent years that the three-dimensional structure of GDH from microorganisms is available. Very recently, crystallization of bovine liver GDH was reported for the first time from the mammalian sources. However, remarkably little is known about the detailed structure of mammalian GDH, especially the brain enzymes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, WB
Publications for Glutamate Dehydrogenase Antibody (NBP3-16582) (0)
There are no publications for Glutamate Dehydrogenase Antibody (NBP3-16582).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glutamate Dehydrogenase Antibody (NBP3-16582) (0)
There are no reviews for Glutamate Dehydrogenase Antibody (NBP3-16582).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glutamate Dehydrogenase Antibody (NBP3-16582) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glutamate Dehydrogenase Products
Research Areas for Glutamate Dehydrogenase Antibody (NBP3-16582)
Find related products by research area.
|
Blogs on Glutamate Dehydrogenase