Glucuronosyltransferase 1A1/UGT1A1 Antibody

Images

 
Western Blot: UGT1A1 Antibody [NBP1-69448] - This Anti-UGT1A1 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 2.5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glucuronosyltransferase 1A1/UGT1A1 Antibody Summary

Immunogen
Synthetic peptides corresponding to UGT1A1(UDP glucuronosyltransferase 1 family, polypeptide A1) The peptide sequence was selected from the middle region of UGT1A1 (NP_000454). Peptide sequence ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGT1A1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2.5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against UGT1A1 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-69448 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glucuronosyltransferase 1A1/UGT1A1 Antibody

  • bilirubin UDP-glucuronosyltransferase 1-1
  • bilirubin UDP-glucuronosyltransferase isozyme 1
  • Bilirubin-specific UDPGT isozyme 1
  • GNT1
  • GNT1EC 2.4.1.17
  • HUG-BR1
  • UDP glucuronosyltransferase 1 family, polypeptide A1
  • UDP glycosyltransferase 1 family, polypeptide A1
  • UDP-glucuronosyltransferase 1-1
  • UDP-glucuronosyltransferase 1-A
  • UDP-glucuronosyltransferase 1A1
  • UDPGT 1-1
  • UDPGT
  • UG-BR1
  • UGT1
  • UGT1*1
  • UGT1.1
  • UGT1-01
  • UGT1A
  • UGT-1A
  • UGT1A1
  • UGT1AUDPGT 1-1
  • UGT1BILIQTL1

Background

UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids. Mutations in this gene result in Crigler-Najjar syndromes types I and II and in Gilbert syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59786
Species: Hu
Applications: WB
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
H00054659-M02
Species: Hu
Applications: WB, ELISA
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-69412
Species: Hu
Applications: WB
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-06724
Species: Hu
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448) (0)

There are no reviews for Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucuronosyltransferase 1A1/UGT1A1 Products

Bioinformatics Tool for Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448)

Discover related pathways, diseases and genes to Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448)

Discover more about diseases related to Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448).
 

Pathways for Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448)

View related products by pathway.

PTMs for Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448)

Learn more about PTMs related to Glucuronosyltransferase 1A1/UGT1A1 Antibody (NBP1-69448).

Blogs on Glucuronosyltransferase 1A1/UGT1A1

There are no specific blogs for Glucuronosyltransferase 1A1/UGT1A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucuronosyltransferase 1A1/UGT1A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT1A1
Entrez
Uniprot