Recombinant Human UGT1A4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human UGT1A4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 34-128 of Human UGT1A4

Source: Wheat Germ

Amino Acid Sequence: VPTDGSPWLSMREALRELHARGHQAVVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNVSLALHRCC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
UGT1A4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UGT1A4 Protein

  • bilirubin UDP-glucuronosyltransferase isozyme 2
  • Bilirubin-specific UDPGT isozyme 2
  • GNT1
  • HUG-BR2
  • polypeptide A4
  • UDP glucuronosyltransferase 1 family, polypeptide A4
  • UDP-glucuronosyltransferase 1-4
  • UDP-glucuronosyltransferase 1A4
  • UDP-glucuronosyltransferase 1-D
  • UDPGT 1-4
  • UDPGT
  • UGT1
  • UGT1*4
  • UGT1.4
  • UGT1-04
  • UGT-1D
  • UGT1DEC 2.4.1.17

Background

UGT1A4 - UDP glycosyltransferase 1 family, polypeptide A4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-49113
Species: Hu
Applications: IHC, IHC-P
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
H00007366-B01P
Species: Hu
Applications: WB
H00054575-Q01
Species: Hu
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-20803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00054657-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for UGT1A4 Partial Recombinant Protein (H00054657-Q01) (0)

There are no publications for UGT1A4 Partial Recombinant Protein (H00054657-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT1A4 Partial Recombinant Protein (H00054657-Q01) (0)

There are no reviews for UGT1A4 Partial Recombinant Protein (H00054657-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT1A4 Partial Recombinant Protein (H00054657-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UGT1A4 Products

Bioinformatics Tool for UGT1A4 Partial Recombinant Protein (H00054657-Q01)

Discover related pathways, diseases and genes to UGT1A4 Partial Recombinant Protein (H00054657-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT1A4 Partial Recombinant Protein (H00054657-Q01)

Discover more about diseases related to UGT1A4 Partial Recombinant Protein (H00054657-Q01).
 

Pathways for UGT1A4 Partial Recombinant Protein (H00054657-Q01)

View related products by pathway.

PTMs for UGT1A4 Partial Recombinant Protein (H00054657-Q01)

Learn more about PTMs related to UGT1A4 Partial Recombinant Protein (H00054657-Q01).

Blogs on UGT1A4

There are no specific blogs for UGT1A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AHR Antibody
NB100-128
UGT1A4 Antibody
NBP1-69412

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UGT1A4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT1A4